DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dhc62B

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_995958.2 Gene:Dhc62B FlyBaseID:FBgn0013811 Length:3964 Species:Drosophila melanogaster

Alignment Length:4159 Identity:1229/4160 (30%)
Similarity:1972/4160 (47%) Gaps:545/4160 (13%)


  Fly   698 DVSVNLTKFFCREDELWQARVKLMRIAE-WYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIK 761
            ||.|.:.:      :.||....:..:.: .|.|...|    |.|.|....:|...:.| :|.|. 
  Fly    52 DVKVRVAR------QQWQPEPDMRLLPQSHYEDNLRR----EVRKIVVPPMLRRTEAK-ILSFA- 104

  Fly   762 WNAFSQRFIVMIFKMVK-YLHD------RLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLH 819
                |:|......::|: |:||      ||:    .:.::|..:|.    |.|..:|  ||....
  Fly   105 ----SERLKNKYPELVQAYMHDVHEEFNRLM----KVYSMKNILRH----PEFSDED--PAQFEL 155

  Fly   820 TDP----REPILSIRAANAADTQRLID---LLMYVNLKLFFDI-----PR-----RYSLPPGEHG 867
            ..|    |.|..:...:|..:.:|.|.   |::.:.|:...:|     |:     .|.|..|...
  Fly   156 PRPDIGFRRPGRTQNYSNFLENRRRIAQKLLILQLPLRAILNISVGELPKLACIFNYVLATGAMQ 220

  Fly   868 EEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLS 932
            ::           :.|....::.:|              |..:..:::.:.:..|.|:.....:.
  Fly   221 QQ-----------LGLGGREALSYK--------------FYHKYIQNQLDKVNTFLRWTWYPKIV 260

  Fly   933 QEERALFREYEIYVDEIIAENLVDSVITSSTYLR----ME-VDNRYENNTPI---FEIFMELQEP 989
            |..|.|.|:               .|:..||:.|    || :.||...|..|   .|::.....|
  Fly   261 QVLRKLMRK---------------RVMPMSTWKRSWNAMEALMNREMTNMKIRTFEEMYRMCSHP 310

  Fly   990 NVVYF--RNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEV-----------------TN 1035
            ..:..  .:|:.|.       ..:.||...|..|:|:..|:..||:                 |:
  Fly   311 RTMPMMRMSLEWSE-------FSSDLDTRPNAWSILRTFAEIATEISMVGYRMEPLQPQVQTLTS 368

  Fly  1036 MNPYSFYD-----ELQD---KSELDKQRVEIMNKIKLALQAVRVHGKGFME-FSSLWIWDK---- 1087
            |..|:..:     |:.|   |..:||    :.|.|....|.|..:.:||.: :.:|:.|.:    
  Fly   369 MAAYAKVNDYLKIEMNDNFLKDVIDK----VQNIILRTYQEVIQYVEGFRDKYYALYSWQERDAL 429

  Fly  1088 STYLSEVKKF-------------------------------------------GRNL-----TLD 1104
            :.:|||..:|                                           ..||     |:.
  Fly   430 NQFLSEPHEFEEYFARIDMYYGFIQMLRSEPATEYFVMAVIHNEPAIFGLRTLAENLIHEITTII 494

  Fly  1105 ERD---AEADL-EGSSGVKLLGLEYPPLSVYKEQL------------DKFIELQDQIRTWETYED 1153
            .|:   ||.|: :....:|...||.|..:   |:|            ||..||.|:|:       
  Fly   495 IREHIKAEVDICDEFEKIKYRALEIPKST---EELLESAEYMIHVKKDKIAELTDRIQ------- 549

  Fly  1154 FFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVD-------------EANIV 1205
                 .....|..:..|::    :|.:..||..:..|.:|::.|..|             |.::.
  Fly   550 -----YCLQVGTNIVELTE----MSKYHFDLTIKTINWIKDINDICDYNASQQEQFKFTFEEHLQ 605

  Fly  1206 LKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDA 1270
            ..|:....|.:.|:..|:|::.::......|| :..|:..||.|:.:     |..:|.||     
  Fly   606 EVIKKLNSDIDELLPKLTVIDDMSRPDKFRDS-YIILQNFIDQLKTF-----DDYVAWIN----- 659

  Fly  1271 WMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFF--FVPCLSCYELIDE 1333
              |.::|             ::|.|.|            |.|..:.|.|.  |...:.|      
  Fly   660 --KEEKL-------------FKVALTE------------YPKLDIIKTFVYPFAELMKC------ 691

  Fly  1334 SDLELVALEERQRSLAE-SAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPW 1397
                   ..|.||.|:. :...||...|.                      .::.|.:|:.|...
  Fly   692 -------CIEWQRYLSVWNDGPFEYLEPQ----------------------FVERTTDDYLKEFQ 727

  Fly  1398 K-------KIDIENMDQECKKFGRELRGLDKA-----MRTWEPFIFMEASLKNLMTSLRAVTELQ 1450
            |       ||..:.:|....||..:....|.|     :|.....|   .|:|:..|.:..|..:.
  Fly   728 KNQKYYRVKIKQDLIDNPVCKFKGQTEDPDPAKHPVPLRLCTSMI---QSIKDFTTGVFIVNTMC 789

  Fly  1451 NPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIAT 1515
            |||:|.|||.|:.:......:.|..|||:.:::..|....::.:.|...:.||:.:...|:.:..
  Fly   790 NPALRKRHWKEMSEIAGFDVTPDAGTTLRKILNSGLDPILDQFEIISIGANKELQLWNALQAMIK 854

  Fly  1516 AWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQ 1580
            .|.|..|....:..|.:::|.:.:::...|:||..:...|..|.::...|.|||.|..::...::
  Fly   855 EWETRVFPYGPYKETGVQILSSLDDIQALLDDHILKTLVMRGSAFMKPCEEEVRAWYEKIMRVNE 919

  Fly  1581 IIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGS 1645
            .:..|.:||..:.||..|| .|:||.:|:||:.|.|..:::.:...:..:.....|:.:...|| 
  Fly   920 TLDQWGKVQANYLYLLPIF-SSKDIVAQMPEEGRLFVIVEQTYTRNMGLVLRQPLVMETAPVSG- 982

  Fly  1646 KLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDS 1710
             |.|.|:...::|......:::|||.|||.:|||:|:::.::|:|||...:|..|..||:|.::.
  Fly   983 -LLESLQKANELLEDIATGVSNYLEKKRLYFPRFFFLANDEMLEILSETKDPLRVLPHLSKCFEG 1046

  Fly  1711 MGKLNLISGSKNAAGMVA--KELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFY 1773
            :..|. ...:||...|::  ||..|::..:......|.||.||..:.|:|...:|.|.:.|...|
  Fly  1047 INSLE-FDAAKNVLAMISSDKETIEFIEQVSTAAAGGSVEKWLIGVEDEMLKAVRYQNELSFAHY 1110

  Fly  1774 DHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLG- 1837
            ....||.|:.|||....|..:|:.|.:..:....:........:.::.::...:||:::.|:.. 
  Fly  1111 PKVKRHEWVLEWPQMTVLAISQVYWASRVHGCLRRTFGGNMTIMMNFFQELSKELNDIVTLVRSP 1175

  Fly  1838 DLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFR 1902
            .::...|..|.::..||||::||...:|..||..:..|||.:|:|:.|:.  |..:..|.:|...
  Fly  1176 KISNLNRITIKSLIVIDVHAKDVSEDLIKNKVSSEFDFQWLAQMRYYWED--DKTWVRIINATVP 1238

  Fly  1903 YDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNC 1967
            :..|||||:.||||||||||||.||..:..|.:.|||.||||||||||||||.:||.:...||||
  Fly  1239 FANEYLGNSDRLVITPLTDRCYRTLVGAYQLHLNGAPEGPAGTGKTETTKDLAKALAVQCKVFNC 1303

  Fly  1968 SEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIA 2032
            |:.:|||::|...||||..|||.||||||||.:|||||||.|:..|..|::|....|.|.|..:.
  Fly  1304 SDGLDYKAMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILLIIQAVRSNATKFMFEGTELT 1368

  Fly  2033 LRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITL 2097
            |.....|.||||||||||:|||:|||.|:|..||:|||:|:|.||.|.:.||.:||.||.|.:|.
  Fly  1369 LNPACYVCITMNPGYAGRSELPDNLKVLFRSVAMMVPDYAMIGEISLYSYGFVDARKLAVKIVTT 1433

  Fly  2098 YTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFM 2162
            |.||.|.||.|:|||:|:||:|:||...|.:::......||.:|:|:|.|.|:||.::.|||:|.
  Fly  1434 YRLCSEQLSSQNHYDYGMRAVKTVLSACGNIKKQYPDEVEDILLLRSLIDVNLPKFLSFDVPLFE 1498

  Fly  2163 GLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTG 2227
            |:|.|:||.:.:|.......|:..||..|:..|:|...|:||::|..|:..|||...::|....|
  Fly  1499 GIISDIFPGIKLPHIDYSLVESEFKRVCLEEVLEPAPSFLLKVIQTYEMIIVRHGFMLVGEPLAG 1563

  Fly  2228 KSEVWKTLNKTYQNQK----RKPHY------NDLNPKAVTNDELFGIVNPSTREWKDGLFSILMR 2282
            ||:..:.|.|.....|    :|.:|      ..:|||::|.::|:|..:|.:.||.|||.:.:.|
  Fly  1564 KSKTLQVLAKVLSALKIKAPQKSNYFQHVQMGIMNPKSITMNQLYGSFDPISYEWTDGLVAKIFR 1628

  Fly  2283 DQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATP 2347
            |.|.......||::.||.:|.:|||::|||:||||.|.|.|.|.|.::.||.::||:..|..|:|
  Fly  1629 DFAMTPTPDRKWVIFDGPVDAVWIENMNTVLDDNKKLCLTSGEVITMSNEMSMVFEVMDLAQASP 1693

  Fly  2348 ATVSRAGILYINPQDLGWTPFIQSWLGTR----TNSSEVSMLNVLFDKYVPPLLDIFRTRLRSIT 2408
            |||||.|::|:.|..|||..|.:|||...    .:...|..:..|....:||.....|.......
  Fly  1694 ATVSRCGMIYMEPSTLGWRAFAKSWLKKADPRWADEEGVPYVMALMQWLLPPCQTFVRRFCSQFI 1758

  Fly  2409 PISDIARLQMTCYLLDSMLTP--QNVPNDCPKDWYEIYF----VFCIVWGFGSSLFQDQIIDW-S 2466
            ...:...:..|..|.|..:..  :..|.|..| :.:.||    :|.::||.|.      ::|. |
  Fly  1759 KPGEFNCMLTTFDLFDMQIAEAIEENPEDYQK-YLQTYFQAAILFALIWGVGG------VLDTAS 1816

  Fly  2467 NEFSKWFLNEY-------------KAVKFPLSGTIFSF-YIDHETKKFFPWTNLVPQFELDMDLP 2517
            .|....||.:.             ..:..|..|.:..: ::..:...:..|.:|..:  :|::..
  Fly  1817 REKFDVFLKKLWDTDPPPPEPLGKMEITPPTEGLLVDYVFLYKQRGAWRYWPDLAKR--MDVEET 1879

  Fly  2518 LQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTI-LMNAKLSALPSDKYSVTNVPFNFY 2581
            ....:|.|.:|.|....:...:|....::|:||:|:|||: :.|..::.|..:.:....:.|...
  Fly  1880 KTGVIVPTVDTARYIHLLKMHVEHKKRMLLVGPTGTGKTVYVQNYLMNKLDKEVFETGFITFTVM 1944

  Fly  2582 TTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYD 2646
            .::...|.:|...|:|.....|||....:.:.||||||||..:.|....|..|:|||.||.|.||
  Fly  1945 ISANQCQDLLISKLQKWKRGIYGPPKGMQSVLFVDDMNMPVKEVYGAQPPLELLRQFFDYGHVYD 2009

  Fly  2647 RQKMTLRDIHKCNIV-ACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPI 2710
            .:..:...||...|: ||..|......:..|...||..:::|..|.|::|.|..::       .:
  Fly  2010 LKDSSKVYIHNVLIMAACGLPGGSRQDVYARFLNHFNVYSINTFSDDSMFRIFLNV-------AL 2067

  Fly  2711 QKFDKA-----VIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETC 2770
            ..|.:|     |..:...:|:...:::..|.|....|..|.||.||||||:.:.||......|:.
  Fly  2068 NGFRRAGHGQDVFVVTNQIVSATQSIYKSVQSEIRATPSKSHYIFNLRDISRVVTGCTLVRKESV 2132

  Fly  2771 PNSNQMIRLWIHECYRVYGDKLVDYTD-------IN-----SFK-KIVSDIVRKGIEGVNDDVVY 2822
            .:....:|:|.||..||:.|:|||..|       :|     :|| |:.:...|..::| .|:.|:
  Fly  2133 SDKKIFVRVWYHEAMRVFYDRLVDDVDRKWMFDKLNECLKANFKDKVETVFERYCVQG-PDEAVF 2196

  Fly  2823 AQP-----LIYCHFAKGLT--DIKYMPISGWDRLKSLLDEAQDRYND-YIGAMNLVLFDDAMSHV 2879
            ...     |...:|.:...  :.:|..:...:...:|...:.|.||. ....|::.||..|:.|:
  Fly  2197 TMEAASNILFGVYFDEDSVPDERRYEEVPSVEVFLNLALTSLDDYNSTRRNKMDITLFTFALQHL 2261

  Fly  2880 CRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAG 2944
            .||.||:......||:||:||||:||||:||:.:.....||.::||:|..:|...:|..:..:||
  Fly  2262 NRICRIISIQGASALIIGLGGSGRQSLTKLATNMVQTSFFQPEITKNYGANDWHDDIKAILKEAG 2326

  Fly  2945 VKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRE-- 3007
            .......||:|::::..|.||..::.||..|::..:||.||.:.::..||...:.    .||.  
  Fly  2327 GMNKHTTFLITENQIKMELFLQDIDCLLNQGEVPNIFPIDEKQEVLEMVRLAAQG----GNRNID 2387

  Fly  3008 ----NCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRF 3068
                ..:.:|:::.:..|.::|.|||:|..||.|.|.:|:||||.||||:..||::||:.::...
  Fly  2388 VSALQVFSFFVDRCKQKLHMILSFSPIGDALRTRVRLYPSLVNCCTIDWYDSWPEEALQMIAKMS 2452

  Fly  3069 LSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKA 3133
            |.::.|..:::.|.:.:...:.|.|....::.:.....|:.|.|..||:|||..:..|:..|...
  Fly  2453 LVDVNVPSEDIKLAIMDTCQYFHTTAARSTRAFCQMTGRHIYQTNASFIELIRSFQTLIERKQSE 2517

  Fly  3134 NLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFAS 3198
            .:..::|...||..||.....:..:|..|...:.:|....:.:..:::       :::||...||
  Fly  2518 TMLAKMRYIGGLDTLAQAAAAISIMQRDLNALQPKLVALAESSRKMML-------EINKETLAAS 2575

  Fly  3199 KEEKNVRQIEEDVTAKAKL-------CEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDA 3256
            ...:.|::.||..:.:|:.       ||.|..||.|.|..|..|||||...::|.:||..:||..
  Fly  2576 AAAEQVKRDEEVASVQAEAAQVLKQDCERDLAKAIPVLEDALAALNTLKPADITLVKSMKNPPPV 2640

  Fly  3257 VVSVCGAVLVLFSSKGKIPKDR------------SWKACRAFMGNVDKFLDNLINYDKKHIHPDV 3309
            :..|..||.|:   || ||.:|            .|...:..:|.:: ||..|..:||.:|..::
  Fly  2641 IKLVMAAVCVI---KG-IPPERIPDPASGKMVQDYWGPSKRLLGEMN-FLPGLKEFDKDNIPTEI 2700

  Fly  3310 IKAL-QPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARD 3373
            :|.: :.:|.:.:|.|:.:...||||.|||.|:|.:..:.:|..||.||:..|..:|||..|..:
  Fly  2701 VKRIHKEFIPNKDFDPKVVAKASSAAKGLCQWIIAMMMYDEVAKVVAPKKAKLAGAEKEYADTME 2765

  Fly  3374 KLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESV 3438
            .|.........|||::..|.:|.|:|.|:.||.::.|......:..|..|||||..||.||.::.
  Fly  2766 FLAQKRALALALEEKVALLNIELDKANAEMQKTEEHAESCRNKLLRAEALIGGLGGEKSRWNKAA 2830

  Fly  3439 KVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICD 3503
            :.|......||||:||....|:|:......||.|. .|.|..  |.:...||.:......:::..
  Fly  2831 EDLQELYDHLPGDVLISCGIIAYLSAVNLQYRSEC-VKDWFK--KVTDLKIPCSSHYSITDVLGL 2892

  Fly  3504 DAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLSQRNYL 3567
            :..|..|...|||:|..|:|||.|...|.||.|.||||.|...|:|. :....|..::.:|.||:
  Fly  2893 EVTIQNWQLDGLPNDEFSSENAIISANSSRYSLFIDPQAQANNWLKNMERKNRLNCVKFNQSNYM 2957

  Fly  3568 DQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRLILHTKLA 3630
            ..:..|:..|:.::|||:.|.::..|:|:|.||...:|.:  :.:|:..:..|..|||.:...|.
  Fly  2958 KVIAEALEYGTPVIIENVQEELEVPLDPILMRQTFVQGGIKHISLGESVVPVNPNFRLYMTCNLR 3022

  Fly  3631 NPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDL 3695
            |||:.||...:.|:|||.:|::.|.||||:.||..|||||:.:|..||.:....|..|:..|:.:
  Fly  3023 NPHFLPETFNKVTVINFALTQNALMDQLLSIVVAKERPDLQELRITLTTEAAANKGALRDAENMI 3087

  Fly  3696 LARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFI 3760
            |..||:.|| :||:...:..|..:|..:.:|..|...||.|..:|::.|..|:|.|..:||:|:.
  Fly  3088 LKTLSAGGD-ILENEAAIQILADSKGLSKDIVEKQEAAKETVAKIEAFRLNYKPVAVHSSILYYS 3151

  Fly  3761 LNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKD---RVENLIDSITFCSFVYTSRGLFEQD 3822
            :.||..|:|:|||||..:   .|..|.....|.|.||   |::.|:|..|...:....|.:||:|
  Fly  3152 ITDLPNIDPMYQFSLNWY---INLYMYSIETANKSKDLPRRIKFLVDGFTRNLYNNVCRSIFEKD 3213

  Fly  3823 KLIFLTQLCIQILVNLGEVEPTELDFLL-------RFPYMPNQTSNFTWLTHVGWGGIRALNNQA 3880
            ||::...|..:||:..|:||......|:       ..|..|:.    ||:|...|..:..|....
  Fly  3214 KLLYSFILTARILLGTGQVEMRHFAHLVTNAKESTNIPPNPDP----TWITETVWLNVLRLEELK 3274

  Fly  3881 VFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEE 3944
            ..:|:....:.....|:...|..|||.:..|..|:.| :|.:::.:::.:|||.:..|:|.||.|
  Fly  3275 ELRGIVDHFKSHLHAWQAIYDHSSPEKQPLPPPWQDKTTAFEKIIVLKALRPDSVFLAVRLFIAE 3339

  Fly  3945 KLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDV----EKLGKSLGFSFDHENFHSVS 4005
            .:|.:|:.....:.|:::.:|:..|.:.|:||||.|||..:    ||:|:       .|.|.|:|
  Fly  3340 SIGDQYVTPPEFDISKSYADSTALTPLVFILSPGADPLGSLLAFAEKMGQ-------EETFQSIS 3397

  Fly  4006 LGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGD 4069
            |||||..:|...|:.|.:.|:||.|||.||.|.|:|.||...|: ...|...::|::|:|.|...
  Fly  3398 LGQGQGPIATALIKNAQEMGYWVCLQNCHLAASWMPYLEYLWENMDTFNTTPNFRIWLTAYPTPQ 3462

  Fly  4070 PAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEM---CSKETE-FKAILFSLCYFH 4130
                 .|..||::.:|:|||||||:..|:.::.::......|.   |:|:.. |..:|:.:|:||
  Fly  3463 -----FPVTILQNGVKMTNEPPTGLKENLMRSYNSEPINDYEFYTGCAKQDRAFTRLLYGICFFH 3522

  Fly  4131 AVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWD 4195
            |||.||||:||.|||.:|.||..||.|||..|...|.....||::.:.||..|..|||.:||:||
  Fly  3523 AVVQERRKYGPLGWNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWD 3587

  Fly  4196 RRLCRTYLEEFMQPELI-DGELEYCQG--FPAPGILKYTGYHNYIDDNLPS-ESPSLYGLHSNAE 4256
            |||..|.|.:|...:.: |....:...  :..|...::.....|:|:|||| ..|.:||||:|:.
  Fly  3588 RRLIVTILADFCNAQAVTDNRYRFASDDRYILPRKTEHREILRYLDENLPSLAPPEVYGLHANSG 3652

  Fly  4257 I-GFLTTVSERLFRIVFELQPRMTGGSSGGETVSQE--DIIKNI---------IEDILDKTPTPF 4309
            | ..|.|....|..::..|.....|.:..|.:|.|.  |.||.|         ||...:|.|..:
  Fly  3653 ITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEKYPVDY 3717

  Fly  4310 NILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQ 4374
            |  |.|.         .|..||.||...|..|::.:..:|.:|:||.:.::..:|::|..:..::
  Fly  3718 N--ESMN---------TVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNR 3771

  Fly  4375 VPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARK 4439
            :|.:|...:||.:..|.|:..||..||..|..| .....|.:.||:|||..|:.||..||..|||
  Fly  3772 IPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDW-HHHGKPPTFWLSGFFFTQAFLTGAMQNFARK 3835

  Fly  4440 NEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLY 4504
            .:.|:|.:..:.||.|  .|..|:.|.:|.|.|||::|||||:.:..|:.:.|.|.|..||||::
  Fly  3836 YKIPIDTLTFDYDVLK--VETKTSPPDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIF 3898

  Fly  4505 IKAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLLLQT 4559
            .:.|........:.|.||:||...|..|         :|....|.:..:||.|....|.|:.||
  Fly  3899 FRPVGLVDVVEGSRYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKASHWVKRSVALICQT 3962

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 15/66 (23%)
DHC_N2 1368..1770 CDD:285579 107/416 (26%)
P-loop_NTPase 1903..2132 CDD:304359 132/229 (58%)
P-loop_NTPase 2217..2352 CDD:304359 55/145 (38%)
P-loop_NTPase 2510..2783 CDD:304359 78/280 (28%)
P-loop_NTPase 2860..3127 CDD:304359 89/274 (32%)
MT 3140..3480 CDD:289543 110/360 (31%)
AAA_9 3509..3722 CDD:289547 80/216 (37%)
Dynein_heavy 3864..4549 CDD:281078 241/720 (33%)
Dhc62BNP_995958.2 DHC_N2 678..1102 CDD:285579 116/466 (25%)
P-loop_NTPase 1239..1469 CDD:304359 132/230 (57%)
P-loop_NTPase 1553..1699 CDD:304359 56/146 (38%)
P-loop_NTPase 1874..2145 CDD:304359 78/278 (28%)
P-loop_NTPase 2249..2511 CDD:304359 87/266 (33%)
MT 2524..2864 CDD:289543 107/352 (30%)
AAA_9 2898..3111 CDD:289547 79/214 (37%)
Dynein_heavy 3253..3952 CDD:281078 243/729 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.