DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and CG9068

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_611111.1 Gene:CG9068 FlyBaseID:FBgn0034106 Length:1227 Species:Drosophila melanogaster

Alignment Length:1345 Identity:243/1346 (18%)
Similarity:473/1346 (35%) Gaps:349/1346 (26%)


  Fly   102 SLLIGDLL-----PNPLANLSILCDEVFFPLLNNTV-----------------NQVGWTNVIAND 144
            |:.:.||.     ||.:.::....||:.|..|.:.|                 |.:.|...:.|.
  Fly   104 SMCVSDLSYFRREPNEIFSVEGFHDEINFGTLTSDVDGCLMELLDRLYVPFFRNYLEWNATVRNR 168

  Fly   145 MKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWL 209
            ..:........::.|...:...::..:|..:.| :.|.|         |:..:..|||.:.:.|.
  Fly   169 FCSSMDRFLAFLSGMHHQISGMSVMYVPFVIKE-LTAGP---------VDRYLVGSLEGIALYWT 223

  Fly   210 DSVEDLVNIKAGEKIYSKENFPLPEAI------FSFWESRLENLENLAEQLGDRRIKTIGFVLEK 268
            ..:..|:         :.:...:|..:      |.|||.|.|.|:.:.:||....::.:..:|..
  Fly   224 TQIRTLL---------ADDTLTVPHDLVTVRDEFEFWEYRYEVLQGINDQLAHSDVQKVLLLLHN 279

  Fly   269 IQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLML-TIGLVWG 332
            .||:.......::|...:.|.::....|.|..|.....|.:......:.:.:.|.:: .|..:|.
  Fly   280 AQSVHMPQMDGLIERARKELHKSLSNIKYLHLLIEPCSKIDAATSPADLTKLLPRIIHLIRFIWL 344

  Fly   333 HSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECR 397
            :|.|::|...:...|....|.:|....:..:.:.|..|......:..::.::....|:.||:...
  Fly   345 NSEYYNTTRLIAALFRNLSNQIIRFCTKQTKVEEILSGKPRFGIRICNVAIECCLTYRGIYDTIS 409

  Fly   398 NSLKKFKIGTTFNSQDWTWHQDE--IFGRLDKFLVRLEELKDLFNTVRDFQKLE------KIVMG 454
            ..|.:       ......|..||  ||..:|.|:.||.::.|:..::..|.:|:      |.|.|
  Fly   410 RDLAQ-------KHTQMPWELDEGLIFNHIDAFVERLNDVIDICESMIVFGRLDENGSIPKPVFG 467

  Fly   455 GLKGRQITFALEKILEEYNSIYREWTN-IQYNP---------IDPDAENSLFQRDRLSFKAKTDV 509
            |..|.:    ||||.|.....:.:..| :|.|.         .|..|:.:.|:::....:   :.
  Fly   468 GTCGEE----LEKIAESVEVQFLDTLNKLQQNSQAYILNVHRADWYADVAGFRKNMQKLE---ET 525

  Fly   510 MERMV--SFQFEKGLEDTHDLLLA---------GSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVK 563
            ::|::  .||....:|:..:.|.|         |:  ||....|....|..:    |.:|:....
  Fly   526 VQRLIFNVFQQVSNVEEMLEALQAMLFYSYRQRGT--LRKTYLKETSKLWRM----FSKEMDATS 584

  Fly   564 KEFIN--------FKNVFTALGL-----------NELPTDDCFPKV---SGAISFLKKLRHRIIG 606
            ::.:.        .|:|..|||.           :.|...:..|.|   |.|::....|||.   
  Fly   585 RKLLEEQSRESWLSKHVSIALGYRINLERLTWLRDRLKNSEWLPAVKESSPALAKFDALRHE--- 646

  Fly   607 LHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDIT------LTL 665
                        |..|                   .::..|.|..:|. |...|:.      |.:
  Fly   647 ------------FQKE-------------------IRLAYDDWVAKCC-GFSGDLCQRLDRYLVV 679

  Fly   666 IEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDT 730
            ..|.....|..|....::...:..:....:|..:...:.|.:.|.|.:......::::|..:|..
  Fly   680 RSKKFKGLLECNIDASVLELCEQAQHFERMGFAIPSTMKKLYERYDTIRSLYNGIIKLALSHNRI 744

  Fly   731 FERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNA-FSQRFIVMIFKMVKYLHDRLVAAQENLEAI 794
            .......|::|....:...:.|:.|.:..|.:.: |::.|.                 ::..|.|
  Fly   745 LAVLSDRERKLFRPLIQACDRQLAPGVFKITYGSEFNEEFF-----------------EDGTEFI 792

  Fly   795 KESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRY 859
            .|          ||               |.:|..:.||.. ..|:.:.:....|..|       
  Fly   793 AE----------FQ---------------ELVLIFKRANRG-VARICEKICGTCLLHF------- 824

  Fly   860 SLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQS---ESEEEIITP 921
                                ..|.||                 |:..|:::.|   .|..:|:..
  Fly   825 --------------------AFSGSV-----------------DISVFQQQLSSRLSSSGDILRS 852

  Fly   922 F--HRYELLKGLSQEERALFREYEIYVDEIIAE-----NLVDSVITSS--TYLRMEVDNRYE--- 974
            :  |..|||...|       .:::...||:.||     |.:|.::.||  |..|..::..||   
  Fly   853 YYSHVVELLSAFS-------GQFQSVDDEMSAEWIAYVNDMDDMLASSLMTSARGSLNKLYEALH 910

  Fly   975 -----NNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQD---PT 1031
                 .:.||..:..::::..:|:..::|     .....|..|:|.:.:|:....|:...   |.
  Fly   911 CDADMASAPIIVVESDVKDGRIVFTPDMD-----AIGDMINGIVDSIRSMLDQFPRLGYKLKLPK 970

  Fly  1032 EVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQA-VRVHGKGFMEFSSLWIWDKSTYLSEVK 1095
            :.......|.:.|.|:.|||.:           ::|| :.:..:...::.|.|..::..:.:..:
  Fly   971 KQQRQGFASVFREDQECSELMR-----------SIQAEIGIQREELAKYESEWNKNRVLWQTTEE 1024

  Fly  1096 KFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFV---F 1157
            :|.:.|....|.|                    .|::..::.:..|.|.:    .:||...   |
  Fly  1025 EFRQRLMSKSRTA--------------------GVFEGGIEHYSALADDV----IFEDAITNVYF 1065

  Fly  1158 LRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFV--DEANIVLKIE-------LQKD 1213
            :.:|....|..:|..:.:|.:|....|::...|.:..:..::  :|.| |:|:.       ..|.
  Fly  1066 ILINQNALKSTMLDWIEKWQALNIKMLLDHGSNLMGAVYRYMRRNERN-VMKVPRTIRETVAAKQ 1129

  Fly  1214 DFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLA 1278
            .||.|:|.:.|      ||    |.|.|:.|:..||.:|..:..:....|:..|..||:...::.
  Fly  1130 LFEKLLKDVPV------KQ----SAFTPMLELFVLLHKYQVKLSEETFEQVMGLETAWLHYLQVL 1184

  Fly  1279 ATTKQLIAPIQSYQVDLIEK-----RILLCDNMANTYRKKFLSKK 1318
            ....:::....|....|:.|     :::|.|.:.:.|.|  |.||
  Fly  1185 EEADEMLDNEDSEAKLLLAKHGEKFKLILKDFLEDFYSK--LPKK 1227

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 115/630 (18%)
DHC_N2 1368..1770 CDD:285579
P-loop_NTPase 1903..2132 CDD:304359
P-loop_NTPase 2217..2352 CDD:304359
P-loop_NTPase 2510..2783 CDD:304359
P-loop_NTPase 2860..3127 CDD:304359
MT 3140..3480 CDD:289543
AAA_9 3509..3722 CDD:289547
Dynein_heavy 3864..4549 CDD:281078
CG9068NP_611111.1 DHC_N1 211..784 CDD:285571 116/637 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93126800
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46532
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.