DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and btv

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001036369.3 Gene:btv FlyBaseID:FBgn0023096 Length:4236 Species:Drosophila melanogaster

Alignment Length:4876 Identity:1078/4877 (22%)
Similarity:1934/4877 (40%) Gaps:1193/4877 (24%)


  Fly   204 MVVKWLDSVE----DLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRR------ 258
            |::::|:..|    ..|:.::..:|......|..|....|::         ..|:|..|      
  Fly    31 MILEFLEQEELTVISAVHSRSDGRIRFHHRIPNEELCLLFYK---------VPQVGHHRKEDGSE 86

  Fly   259 ------------IKTIGFVLEKIQSIFEHSYRR---------IVELVLESLAEA-----RDITKC 297
                        :|:|...:.::.|...:|.||         |:|.:.::|..:     ..||..
  Fly    87 PLLGILTLEGGMVKSIYNSVSRVFSPSANSARRSEYGPELSGILENLHQNLGSSLGLPQSGITSL 151

  Fly   298 LSPLK---RKMDKFETNDMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVN 359
            .:.:|   :|:.:..::.:|...:.:               :...|.||..     ..|.||..|
  Fly   152 RNEIKYWQQKLGQKSSSRLDREAAQV---------------FIGVLENMEK-----QISTIDGAN 196

  Fly   360 RTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNSLKKFK--IG--------TTFNSQD- 413
                |....:..:|.|:..||      |.::|.||..:..:....  ||        |...::| 
  Fly   197 ----PSGTIEEFLDHAHTNLD------ELWRLPYNYPQQRMADLLDIIGKRLLEVCLTQLLAEDV 251

  Fly   414 WTWHQDEI-------------FGRLDKFLVRL--------------------EELKDLFNTVRDF 445
            |:.:...:             :.:|...|.||                    ::.|:..:.:|..
  Fly   252 WSLNSSHVNNLMSQSIDTVDAWIQLCDSLTRLFWPNYVKHPWLGDSHVPKRGQQFKERLSEIRSI 316

  Fly   446 QKLEKIVMGGLKGRQI--TFALEKILEEYNSI------YREWTN-IQY-----NPIDPDAENSLF 496
            ::|.|.:...|:..::  .|..:....|:|..      ..:|.. :|:     .|||        
  Fly   317 KQLYKQIATLLEDTELQEMFQEQAPFTEFNIFDTSSLGQNKWHKALQHFEQVLQPID-------- 373

  Fly   497 QRDRLSFKAKTDVME-----RMVSFQFEKGLEDTHDLLLAGSLLLRPII-------KKHVEPLMH 549
              :|::...|..:..     |.|.|.|.|          ..:|:.||.:       ::.....:|
  Fly   374 --ERIAAALKRQLHNHLSNPRQVIFIFSK----------YETLIQRPAVLELLTIEREQFLQSLH 426

  Fly   550 VIVDDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELY 614
            :::.|       ::|..:: .|:....|...:..::|        .:||.::|:|..:.|...|.
  Fly   427 ILLQD-------LRKAMVD-SNMEPDTGHLSVICNEC--------RWLKVVQHQIQEIEKVSHLI 475

  Fly   615 EYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQG------------IQQDITLTLIE 667
                  :.|.|:  |..|..||||.:.|:.|| :...|.|.|            ::.|..:...|
  Fly   476 ------SGREGF--DKINKAVQEIKEETESLL-RTNFEIWSGQCSTAVKSGELRLRDDQAVVKFE 531

  Fly   668 KDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNL-------TKFFCREDELWQARVKLMRIAE 725
            |:....:||.|..:|:...:|::....||.:|.:.|       .|:.|      .|| :|.:||.
  Fly   532 KEGRQLMRVTFNPKLVTFCQDVREFENLGYNVPLELRAAATHAAKYMC------YAR-RLQQIAT 589

  Fly   726 WYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFS--QRFIVMIFKMVKYLHDRLVAAQ 788
            ::|...:|..|.::.::....:.::..::.  :.:.|...|  ||::           |.|.||.
  Fly   590 FHNTIGDRMIPCQRPIMLKNALELQRLVQS--ETVAWQDESSVQRYV-----------DILQAAV 641

  Fly   789 ENL-----------EAIKESIRSWGKVPLFQRKDLNPALLLH------TDPREPILSIRAANAAD 836
            ..|           |..|.|:.......||.:..:....|.|      |..|:....:.|.....
  Fly   642 SKLSSDNTLLVGYHEQAKRSVLKLMSTDLFTQNQIWKDELRHLRELVATLERQGYTHLDAFKLHW 706

  Fly   837 TQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVI--D 899
            ..:|..:|.|..:....|:..:.                   |.|.:.::.     ::||::  .
  Fly   707 DHQLYKVLEYQYILGLLDMNNKL-------------------PDIHVKLVL-----RQRELVFSP 747

  Fly   900 EEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTY 964
            .|:::.|....|.....|....||      |||:..:.||:                |::|.   
  Fly   748 PEEEIRELYFSQLRRFIERPCNFH------GLSEHSQELFK----------------SMVTV--- 787

  Fly   965 LRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQD 1029
                  ||:... |:::...||                                           
  Fly   788 ------NRHHFG-PLYQRAAEL------------------------------------------- 802

  Fly  1030 PTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWI-W-------- 1085
                        :|:|||                               |.::|: |        
  Fly   803 ------------FDKLQD-------------------------------FKTIWLPWIALGCVDV 824

  Fly  1086 DK--STYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLD----KFIELQDQ 1144
            |:  ..:|:|...:.||.              ...|....:...|...:|.:|    ..:.|:..
  Fly   825 DQLCGIHLNEAGDWDRNF--------------RSCKHFSQQLAKLQQAEESIDCIVINVLPLRSD 875

  Fly  1145 I-----RTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINR-VKNSLKELQDF-VDEA 1202
            |     |.||:..:          ..:.|:|:.|         .||.. ::::|:.||:. :||.
  Fly   876 IEYISRRYWESLAN----------SLRTAILTDV---------SLIQEFLQSALQFLQNVPMDEG 921

  Fly  1203 NIV---LKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQI 1264
            :|.   :|.|          ||:|.|.||              ::.::.:|.     ||:.|.  
  Fly   922 SISQSGMKYE----------KIMSKLPQI--------------EKTLEAVRA-----KDSCLG-- 955

  Fly  1265 NELPDAWMKVKRLAATT------KQLIAPIQSYQVDLIEKRILLCDNMANTY-------RKKFLS 1316
                 .|.| :|:.|.:      :||...::::.| ::::::.:..|.|.|.       .:|||.
  Fly   956 -----GWCK-ERVTALSGILLQWEQLQPLLENHAV-ILQRQVDMIKNQAETQLQNLKNEAEKFLL 1013

  Fly  1317 KKFFFVPCL-----SCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVK 1376
            :....:..|     |..::..|..|....|:|::..|.|....|.::.|..:             
  Fly  1014 RWESTISELEANEHSTLDVFKERRLHWQQLQEKKTQLLEECSKFNMEFPAEM------------- 1065

  Fly  1377 IMWDFAITIQSTINDWKKTPWKKIDIENMDQECKK------FGRELRG---------------LD 1420
                             .||:.:|: |.|:::.|:      |..||:.               |:
  Fly  1066 -----------------LTPFTEIE-EQMEKQSKQWQVYDSFLTELQPVLHEEWAIYRRRPYVLN 1112

  Fly  1421 KAMRTWE---------PFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD-DS 1475
            :.:..||         |...:...::.|.::|..:.:||:.::.:|||..:.|....|.:.. .|
  Fly  1113 EFIGKWEGSVHASIDLPSKRIRQQVEQLQSALPILQQLQSESLSERHWARIFQLLNHKETKPLHS 1177

  Fly  1476 TTLKDLI-DLN-LHEYEEEVKNIVDKSVKEMAMEKQLRDI----ATAWGTMEFGTDIHDRTSIKL 1534
            ..|:|:: |.: |....:|:.:||.::..|..:.:.|.::    .||...:...||...: |:.|
  Fly  1178 ILLQDILQDFDVLQSAAQEISSIVRQASSEQIVRQALIELDQWSVTAQLKLITRTDASGQ-SVSL 1241

  Fly  1535 LKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIF 1599
            :|..:|::..:.|:|..||:..:|.....|..:..||::||:..|.::.|....||:|.|||.:|
  Fly  1242 IKDYQEVLNKIGDNQSLLQSANNSAAFESFSDQAELWESRLNTLDALLSSLNHSQRRWVYLEPVF 1306

  Fly  1600 IGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG-SKLYEHLEILLKMLLLCEK 1663
             ||    ..|..:...|..|||:|:.::.::..|..|...|..:. :.:...||   ..|..|::
  Fly  1307 -GS----GTLQHEQALFKRIDKDFRFVMREIEMDPRVTSLTKINNITTIVNALE---TQLARCQQ 1363

  Fly  1664 ALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPA-LVARHLTKLYDSMGKLNLISGSKNAAGMV 1727
            .|..|:..||.|:|||||:...|||::|...:..| ::.||:.||:.....|::.....|.|  .
  Fly  1364 NLMSYITDKRNSFPRFYFLGDDDLLELLGQASKDAEVIQRHIRKLFPGCHSLSIRQVGPNPA--T 1426

  Fly  1728 AKELEEY------------VPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLT-------FY 1773
            :.::.:|            :...:..:..|.:|.|||::...::||||||:....|       ..
  Fly  1427 SSDVNQYSITSVHSAEGDELKLSQPVEMKGDIERWLNQLVTVVQDTLRDQIYECYTGTTGGSDNL 1491

  Fly  1774 DHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQL--------NN 1830
            |.|    .:.::.:|.......:.:|.:...|...:..   ..||...|.:||.|        |.
  Fly  1492 DEK----ILKKYASQVLATARALHFTRQAEQAIGSMSL---GKLKQQLKDEITHLAALKNKSENG 1549

  Fly  1831 LIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPK---IDDC 1892
            .:|.|          |:..:....||...|...:....|...:.:.|..|||:....|   ..:.
  Fly  1550 TLISL----------KLRALLLDLVHYSGVTEQLQKHNVVHTSDWHWLCQLRYYLGKKGGTSGEV 1604

  Fly  1893 FAN--IC----DAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETT 1951
            .||  :|    .|:|.|.||:||...:||.|.||.|||:.|||::|:.:||.|.|||||||||..
  Fly  1605 NANRQVCVRMVYAEFEYAYEFLGQASKLVHTRLTHRCYLILTQAMHMGLGGNPFGPAGTGKTECV 1669

  Fly  1952 KDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDA 2016
            |.||..||.:|.||||.|.:|.:|:..|..|||:.|||||||||||:....||.:::.::.||.|
  Fly  1670 KALGAMLGRLVLVFNCDENVDTESMSLILTGLARCGAWGCFDEFNRLQEATLSSISMLIQPIQSA 1734

  Fly  2017 IKSKKQTFSFLGEHIALRTTVGVFITMNPG---YAGRAELPENLKALYRPCAMVVPDFALISEIM 2078
            :|.:..:.......|.|....|:|:|:||.   |.||.:||.|::||:||..|..|:...|:.:|
  Fly  1735 LKERANSVQIGERQIQLNQHCGIFVTLNPAGAEYGGRQKLPGNIQALFRPIVMQQPEPGEIARVM 1799

  Fly  2079 LVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRD-----DRQRP-- 2136
            |..|||.||..:|.:.:.|:.|..::||.|.|||||||.:|:||:|.|...||     |..:.  
  Fly  1800 LFVEGFTEASAIASRIVELFELSGKMLSAQRHYDWGLRELKTVLMVCGEGLRDQLTSEDNNQSSA 1864

  Fly  2137 --EDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPED 2199
              |..|::|.||...:.|:...||..|..|:.::||.:........:....:..:...|.|...:
  Fly  1865 NFEMSVVVRCLRSSTMSKLAPHDVNRFEMLLRNVFPEIGSSPAPETQLHQSLSAAFAQLGLCRSE 1929

  Fly  2200 GFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGI 2264
            ..|.|.:||.|....|..|.::|..|.|||.:...|.:.....:.|.|  .::||:::..:|.|.
  Fly  1930 RQIEKALQLHEQLQKRMGVVLVGPPGCGKSTIISLLKQALCGTQLKVH--TISPKSMSRIQLLGR 1992

  Fly  2265 VNPSTREWKDGLF---SILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNER 2326
            ::..||:|:||:.   ::.:..:::   ....|||.||.|||.|||:||:|:||||:|||.|..|
  Fly  1993 LDADTRQWQDGVLTHTAVAVNQESS---QVHSWIVCDGSIDPEWIEALNSVLDDNKLLTLPSGWR 2054

  Fly  2327 IALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDK 2391
            |.....:..:||...:|.|:|||:||.||                             :|:.:|.
  Fly  2055 IQFGSNVNFIFETDDVRHASPATISRMGI-----------------------------VNMSYDY 2090

  Fly  2392 YVPPLLDIFRTRLRSITPISDI-----------------ARLQMT-------CYLLDSMLTPQNV 2432
            |  |...|.:..| |..|..|:                 ::|.:|       .:||.|:|...:.
  Fly  2091 Y--PADGILKHEL-SKEPYGDLLQSYVDGNFQYAVNWIESQLLLTHLPGINRAHLLRSLLLQLHG 2152

  Fly  2433 PNDCPKDWYEIYFVFCIVWGFGS----SLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYI 2493
            .....:              :|:    :||.....|...||::..|   |.....::...::...
  Fly  2153 TQSLEE--------------YGAATLRALFGYMPNDRQREFAQLIL---KHANLYVANPNYAELT 2200

  Fly  2494 DHETKKFFPWTNLVPQFELD-MDLPLQ-SNLVNTAETTRLRFFMDTLIEAD----HPLMLIGPSG 2552
            .:|:.:     |.:.|:.:| ::.|.: |.|:.|:........::||::..    .|.|||||||
  Fly  2201 HYESSR-----NSLEQYAVDAIETPEKGSQLIITSYMKSYLDILETLLKTQGTRLPPFMLIGPSG 2260

  Fly  2553 SGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEK---PLEKKAGRNYGPIGNKRMIYF 2614
            ||||:|:  :.:.|.:..|.:..:..:...|...:...|:.   .:....||.|.| ...|::.|
  Fly  2261 SGKTLLL--QRAVLENSGYQLATINCSTQLTPRYILHTLKTHCVTVSGIKGREYRP-KQARLVLF 2322

  Fly  2615 VDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQR 2679
            :.::::.:.|.:...:...|:.|......:|..   .|..|....:..|.:....:..|.||.  
  Fly  2323 MKNLDLCQQDSWGACEVVELLFQLAQRGGFYAE---NLEWIGVSGLQLCASIGGNTGKIAPRY-- 2382

  Fly  2680 HFCSFAVN-------PPSQDALFHI---LNSILSQHMDNP---------IQKFDKAVIKLCENMV 2725
                ||:|       |.|||.|..:   |..:|.:|....         :|...::::...|.:.
  Fly  2383 ----FAINQFVRVSRPTSQDMLEIVQRRLEPLLEEHFRGSENRGRSGVNLQHVSESLMDCFEKLQ 2443

  Fly  2726 TTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGD 2790
            .|...:..:          :.||.|:.:.|..:...:::     .|.|:....|:. |...::.|
  Fly  2444 ATFTNVGGR----------QAHYQFSPKCIMKLLDALVF-----YPASDFNEALYC-ELLGMFRD 2492

  Fly  2791 KLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDR--LKSL- 2852
            :|:....:..|:.|:...:||         .|.:..::           ::|.|...|  |..| 
  Fly  2493 RLISEEHVQQFEGILKQTMRK---------YYGKEKVF-----------FVPKSPKSRGHLHCLT 2537

  Fly  2853 ----LDEAQDRY---NDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLA 2910
                ::|.|.:.   |....::...:.::.:|||.||:|:|..:..:.|::|..|.........|
  Fly  2538 HDEWMEEVQRQVTICNTENYSITAPITEELLSHVARITRVLSRTDAHMLILGQSGGRHLDAIFTA 2602

  Fly  2911 SFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSAC-----------CFLMTDSEVAREQF 2964
            :......|..:|....|.::|...:     :|..::|:|.           |:|....::.:.  
  Fly  2603 ATFQEAKVVTLQGGPSYDLTDFYND-----LKVAMQTAALEQQMSYLLIEQCWLSYVPDILKP-- 2660

  Fly  2965 LVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDN-RENCWKYFIEKVRSLLKVVLCFS 3028
               :..||...:|.|||.||     :..|.:.:||...::. :|:...||:::.|..|.:::...
  Fly  2661 ---IEALLEGSEILELFGDD-----LETVASTLKQAAQLEGYQESMGTYFLKRARDYLHIIIVLD 2717

  Fly  3029 PVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKT 3093
            |..|.::.....||||         |.  |..|..|.......|.:|||:       |:..::::
  Fly  2718 PNSAKVQDYFNNFPAL---------HR--QMDLLYVRGESRETIAILPKQ-------FIELLNES 2764

  Fly  3094 V----------------NDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRL-RL 3141
            :                .|||.      :..:..|.:.:.:||..|.. ::......:|:|| :|
  Fly  2765 IAGGGSGRGKVPTCSHFADISD------ELPSEETSQRYYQLIRTYFH-MYNNAANEIDQRLGKL 2822

  Fly  3142 ENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQ 3206
            :.|:.||||....||.|:.....||..|..|.|.|:..:.::.......:::::...:.::..::
  Fly  2823 QMGVDKLASAHALVDTLKSNAAAQEQALGEKRQLANEALEMISFTMRNANEQKSSMLELKQQTQK 2887

  Fly  3207 IEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK 3271
            ..|.:..:.|..:::..:.:|.|..|..|:..:....|:|::|..:||:||..:...||.|... 
  Fly  2888 SSEQLKIRQKEIQQELAEVEPILAEASNAVGQIKSEALSEIRSLRAPPEAVRDILEGVLRLMGI- 2951

  Fly  3272 GKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEK-------ILA 3329
                :|.||.:.:.|:.             |:.:..| |::|.|    |..|||.       :||
  Fly  2952 ----RDTSWNSMKTFLA-------------KRGVKED-IRSLDP----ARISPENCEAVERLLLA 2994

  Fly  3330 K------------SSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRL 3382
            |            |:|||.|.:||....|:..|...::|.||...|.:|.:..|.|::..|...|
  Fly  2995 KGDSYEAKNAKRASAAAAPLAAWVQASVRYSRVIQSIKPLEREQNELQKNLNAAEDEMQELASGL 3059

  Fly  3383 TELE---EQLNA-LQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTF 3443
            .:::   :||:| ||....||...:.|.|:.:.    |:..|..|:..|:.|...|...:..|..
  Fly  3060 DDVDKRVKQLSAKLQTYTQEAAVLELKLQEASG----TLQAAELLVEKLSAEYTTWSLQLTELKK 3120

  Fly  3444 GIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFE----MICDD 3504
            ..:.|....|:|:..|:|  |......|.......:.|..:    :||     .|:    ::.:.
  Fly  3121 AHKTLDAKTLLIAIAINY--CAGLGLEQRCSSLKRLAADFH----LPS-----DFDLRGSLLTEQ 3174

  Fly  3505 AQIAEWNNQGLPSDRMSAENAAIL--VQSERY-----PLMIDPQLQGIKWVKTKY-GTGLVVLRL 3561
            .||. |.:|||..|....|:||:|  :.|..|     ||::||......|:.... |:|......
  Fly  3175 QQII-WESQGLARDAQIIESAALLREMLSLPYGACPIPLLLDPTQTAAAWLMAHLKGSGRPCELT 3238

  Fly  3562 SQRN----YLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIK-KGTVLKIGDREIDFNSRF 3621
            :..|    |  |:|.||..|..||:.:..:...|||..|.|...:: ....|.||.:.:|.:..|
  Fly  3239 THGNDRLPY--QLELAVRFGKTLLVTDCEQLRPPVLQLLQGHVFVRFNKRQLAIGSKLVDLHESF 3301

  Fly  3622 RLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKI 3686
            :|:|.:|........|.::|..::.||||..||.|||:::.:.::..:||..|..|.|::.|...
  Fly  3302 QLVLISKSHRLDLPEEQRSQLNVLKFTVTAAGLADQLMSKAIVLKNGELEQQRIELLQKEGHLLK 3366

  Fly  3687 TLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEA-KITG-------VQIDSA 3743
            ....::|.||.:||.:..::|::..|:.:|.:.|:.:.:|:    || |.:|       .|..|.
  Fly  3367 QRMEMQDKLLEQLSKSEGDILKNEQLLESLNEIKQGSTQID----EALKQSGQIRDTLLAQFGSL 3427

  Fly  3744 REAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAE-KLKD---------- 3797
            ||    .:.||:..|..|...::::|:....|      |..|:.|:...| |:.|          
  Fly  3428 RE----LSSRAATFYAGLIQGYELSPLVYIEL------FLGALSKSQRDESKVYDCLVRSVYMNL 3482

  Fly  3798 -----RVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLC-----IQILVNLGEV-----EPTELD 3847
                 |...|..|:..|...|..| |..::..:|:....     ..:|..||::     :..:|.
  Fly  3483 ARATSRDSQLSLSLWVCHQAYPDR-LNPKEWELFVNNFMGSSDGSMVLSQLGKLPDCMPKEAQLK 3546

  Fly  3848 FLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPG 3912
            ..:.....|:..|...                     ||||.     .|:.|:::::.:.....|
  Fly  3547 LAMLLQLFPDLRSKLQ---------------------LEKDY-----IWRGFIEAQADDVLPALG 3585

  Fly  3913 EWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSP 3977
                 |:.||:.|.:..|||.|.:.:|....:.||.....:......:..::||.:..|..|...
  Fly  3586 -----SSFQRVLIAQIFRPDLMLHQLRKVSSDLLGISPDASTQPSVEQLLQQSSCDRPILMVSHA 3645

  Fly  3978 GVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPS 4042
            ..||..::.|        :.::.:..:::|:|.|....:.:..|:..|||:.::|:|||    |.
  Fly  3646 ENDPTTELRK--------WANQKYREMAIGKGVEKRVLSEMRQAAIDGHWLCVKNVHLV----PE 3698

  Fly  4043 LEKKMESSLSNVHTS--YRLFLSAEPAGDPAAHILPQGILESAI----KITNEPPTGMMANIHKA 4101
            ...:||..||.:..|  :||:|..|..         :|..|:||    |:..|.|.|:...:.:.
  Fly  3699 FLTQMERELSEIQKSKDFRLWLLCEST---------EGFSEAAIYKCLKVRYEQPKGLKQIVMRL 3754

  Fly  4102 LDNFS---DETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLY 4163
            |.||:   |:.|:...|..:.:.:.|.|.   ||:.:||:|.||||::.|.|...||..::.:|.
  Fly  3755 LQNFAAEQDQKLKNQPKSLKMRLVYFVLT---AVLQQRRQFIPQGWSKYYEFGEADLKAALGILR 3816

  Fly  4164 NY-LEANT-RVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGE---LEYCQGFP 4223
            .. .:.|: :..|..::.|...:.|||.:.:..|..:..|||.:|...:::...   |......|
  Fly  3817 MMDQQLNSGKCDWLLMQRLSEALAYGGRVNNQRDLEILTTYLNQFCSADVLSNRWSPLGLSLSIP 3881

  Fly  4224 APGILKYTGYHNYIDDNLPSESPSLYGLHSNA----EIGFLTTVSERLFRIVFELQ--------P 4276
            ..|.|:  .|:..::....::.||:|||.:.|    ||       |:..|::.||:        .
  Fly  3882 TSGQLQ--DYYAALEKLPDTDEPSMYGLANQAQQQREI-------EQAKRVIKELRGLHYGRGLA 3937

  Fly  4277 RMTGG---SSGGETVSQEDIIKNIIEDILD---KTPTPFNILELMGRVE---DRSPYIIVAFQEC 4332
            :.:||   |.|.:.::....::..|:.:|:   |......|::.|...:   ..||:.:....|.
  Fly  3938 KDSGGAGESKGNDQLTGRQKLEQQIKPLLNLWRKLAASCTIIQTMKEAKTDVGESPWALFVLAEL 4002

  Fly  4333 ERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKL-AYPSMLGLQSWFSD 4396
            :...:|...:.::|:::...||....:..   ..:..|...|:|..|.|| ..|.......:...
  Fly  4003 KLGADLYGIVHQTLSQMHAWLKESQEVDG---STLRTLAEQQIPASWLKLWPGPGSNSAVDFLRA 4064

  Fly  4397 LMLR-----LRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKK 4456
            |::|     ||..|....||  ...|.....||.::||:.:....:||.....:|:.|....:..
  Fly  4065 LIVRAQAAELRFREQMHLDF--VEDINFVQVFNCENLLSCLKLLQSRKLAVSTERLELQTCGSSN 4127

  Fly  4457 WKEE-----LTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIK 4516
            .:.:     |..||        |.::||:..|....              ..|||...:|  :::
  Fly  4128 LESDSSDIILKLAP--------LKIDGAQSGMGKSN--------------PFYIKYKIKD--EVQ 4168

  Fly  4517 NVYECPVYKIRLRGPTFVWTFNLKSRER------------------------ASKWTLAGVCLLL 4557
            ||........:....:...|.|.:|:.:                        |.:..|||..|::
  Fly  4169 NVSHTTTSSSKYGKNSLYSTQNAESKPKLPLYSRSSRDKLICHLNVDIVTGTAEQILLAGTALIV 4233

  Fly  4558 Q 4558
            :
  Fly  4234 E 4234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 122/687 (18%)
DHC_N2 1368..1770 CDD:285579 108/453 (24%)
P-loop_NTPase 1903..2132 CDD:304359 110/237 (46%)
P-loop_NTPase 2217..2352 CDD:304359 50/138 (36%)
P-loop_NTPase 2510..2783 CDD:304359 61/301 (20%)
P-loop_NTPase 2860..3127 CDD:304359 59/298 (20%)
MT 3140..3480 CDD:289543 88/363 (24%)
AAA_9 3509..3722 CDD:289547 66/226 (29%)
Dynein_heavy 3864..4549 CDD:281078 160/755 (21%)
btvNP_001036369.3 DHC_N1 200..618 CDD:285571 88/476 (18%)
DHC_N2 1072..1481 CDD:285579 106/421 (25%)
P-loop_NTPase 1621..1847 CDD:304359 107/226 (47%)
P-loop_NTPase 1919..>1967 CDD:304359 15/48 (31%)
P-loop_NTPase 1947..2081 CDD:304359 51/139 (37%)
P-loop_NTPase 2565..>2733 CDD:304359 41/183 (22%)
MT 2821..3138 CDD:289543 85/344 (25%)
AAA_9 3179..3401 CDD:289547 66/224 (29%)
Dynein_heavy 3536..>4051 CDD:281078 129/582 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93200525
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.