DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dhc36C

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_523591.2 Gene:Dhc36C FlyBaseID:FBgn0013810 Length:4024 Species:Drosophila melanogaster

Alignment Length:4375 Identity:1344/4376 (31%)
Similarity:2095/4376 (48%) Gaps:674/4376 (15%)


  Fly   478 EWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLLRPIIKK 542
            |.:.:.|....||...|:.|.     ||..:...|.:  .:|..:.:....||.|.:        
  Fly    27 EKSKMLYTRPKPDVLQSILQS-----KANPEYKSRRL--WYELNMPECASSLLDGKM-------- 76

  Fly   543 HVEPLMHVIVDDFEEEIMCVKK-----------------------EFINFKNVFTALGLNELPTD 584
                     ..|..:.|:|.||                       |..:|:.....|.|:  ..|
  Fly    77 ---------KSDLPDNILCAKKQQKKRQKKRESGVAKANYMTMRLEREHFRRKLVELILH--MDD 130

  Fly   585 DCFPKVSG--AISFLKKLRHRIIGLHKEHELYEYPLFDNERGG----YVSDIFNIMVQEIDDFTK 643
            |..|:::.  |:.|..:         :|.|:..|..:  .:.|    :||.:...:::.|.|...
  Fly   131 DQDPELAAQCAVPFPDQ---------EEREILRYYYY--IKHGIDTIHVSPLSKKILKRITDLVP 184

  Fly   644 MLLDKWTVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFC 708
            .||.||.             |.:.::.| |:|.::    :||:|...|..:|...|...|||   
  Fly   185 PLLYKWQ-------------TALNENIA-EVRADY----VFAMKKAVVDFVLRHTVLDRLTK--- 228

  Fly   709 REDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMI 773
                        ..:...| ||.||                 .:::.:.:|.::.....|.::| 
  Fly   229 ------------EGVGGKY-DTAER-----------------REVQSMTNFWRYRYDENRNVLM- 262

  Fly   774 FKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDL----NPALLL--------HTDPREPI 826
             |.:..:| |.||:...|.::|...:|     |...|:|    :|..|.        |.|..:.:
  Fly   263 -KTLFCIH-RSVASILELWSMKYKDKS-----LIDSKELAKVESPFSLFTFVYLCGSHIDNGKTL 320

  Fly   827 L------SIRAA--NAADTQRLIDLLMYVNLKLFFDIP----------------RRYSLPPGEHG 867
            |      .|.::  .|:...:|.|:..:..:|.||:..                :.|:....::|
  Fly   321 LEESWYGEIHSSLLKASKRGQLPDIRRFTLVKRFFNCVAALMTQQLEDICIRSLKEYADFICDYG 385

  Fly   868 EEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLE---EFEEEQSESEEEIITPFHRYELLK 929
            ..:        |...:|||           :.:||.::   .|.:.|||....|.:.....::|.
  Fly   386 HSN--------PGFEISVM-----------LADEDTIQFNPSFSKVQSELLRVIDSIMLSIQMLP 431

  Fly   930 GLSQEERALFREYEIYVDEIIAENLV------DSVITSSTYLRMEVDNRYENNTPIFEIFMELQE 988
            .:         |.::|.|.|:::.:.      :|::       .|..||         |...|:|
  Fly   432 RI---------ESKLYTDLIVSKKIFLTPTVPESIV-------QETKNR---------ICAMLEE 471

  Fly   989 PNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTN-MNPYSFYDELQD----- 1047
            ..:                ..|..|.|.:..:.|:.  ..|...|.| |...:.:::..|     
  Fly   472 QRI----------------GPELRLQDFDPFIDLIN--GSDAERVGNFMESDATFEQYADMVYEY 518

  Fly  1048 KSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADL 1112
            |.:.|:...|:...|::          ||.||      .:..:::.::...|.|.||.. |....
  Fly   519 KEKEDRIAKEVWAVIRM----------GFYEF------HRDKFITHLESLCRQLQLDLL-ARMVT 566

  Fly  1113 EGSSGVKLLGLEY-----PPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQ 1172
            :..:.:..||.||     ..|:|.|:                                 .|.|.|
  Fly   567 DQQARITRLGKEYDAIAKKALTVPKD---------------------------------TAELMQ 598

  Fly  1173 VGQWISLFKLDLI----NRVKNSLKELQDFVDEA-NIVLKIELQKDDFEGLVKILSVLNQ----I 1228
            :..::...:.:|:    .|:|.::.|:...:|.. ...|:|:...:.|:..:|:.|:..|    |
  Fly   599 LKAYVVHAEENLVPEMEARLKVNMSEILWLMDHTLYSPLEIKNNSNSFQWYLKLPSIFEQHRAII 663

  Fly  1229 NEKQCIYDSMFDPLKEIIDLLR---QYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQS 1290
            .||...|..:   ||:.|:|.|   |..||...|.        |.|..:|:|:...|        
  Fly   664 AEKVIEYQEL---LKKRIELFRRELQNYYEQVQTY--------DTWGDIKQLSRYKK-------- 709

  Fly  1291 YQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLF 1355
             :..::::|:                        :...|.||:       :.|.:.|.......:
  Fly   710 -RAGVLDQRL------------------------VQAMETIDQ-------INEEETSYGWDLSQY 742

  Fly  1356 ELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLD 1420
            .::       :.....||..|.::|.........:.|..:.....|.:.:|.:...|.|.::.||
  Fly   743 PMR-------KKAHDQLKPYKTLFDAGQDFMDKWDLWMHSQVGSFDPDEIDGDVSNFYRIIQKLD 800

  Fly  1421 KAMR----TWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDL 1481
            |.|.    |.:....::|.::.....:..:..|.||.::.|||..:.:.......:....||:.:
  Fly   801 KQMGDHPITMQLIQDVKAQIEAFREHMPIINTLGNPGMKARHWELVSEIIGFPIKVSPELTLEKI 865

  Fly  1482 IDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLE 1546
            |:..|.||..:.:.|.:.:.||..:|:.:..:...|..:||....:..:....|.|.:::...|:
  Fly   866 IEYQLDEYVPKFEAISESATKENNLERAMAKMVNEWEGVEFSISPYRDSGTFKLAAVDDIQILLD 930

  Fly  1547 DHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPE 1611
            |...:.|.|.||.||..||.::..|:.:|....:|:..|..||..|.|||.|| .|.||:.|:||
  Fly   931 DQIIKTQTMKSSPYIKPFEADIIKWEAKLMLLQEILDEWLRVQATWMYLEPIF-SSPDIQQQMPE 994

  Fly  1612 DSRRFDYIDKEFKALLAQMNADRNV-----VRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLET 1671
            :.|||..:||.:|.|:.|::.|..|     :...|....|.|..||::       :|.||.|||.
  Fly   995 EGRRFSAVDKIWKELMKQVSQDPKVMVVVQIDKMNDKLKKAYSLLEVI-------QKGLNAYLEK 1052

  Fly  1672 KRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELEE--Y 1734
            |||.:|||:|:|:.:||:|||...:|..|..||.|.::.:..|| .:...:...|.:.|.||  .
  Fly  1053 KRLYFPRFFFLSNDELLEILSETKDPTRVQIHLKKCFEGIATLN-FTEELDVTAMRSSEREEVTL 1116

  Fly  1735 VPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWT 1799
            |..:......|:||.||..:...|:.::..::..:...|....||||:..||.|.....:...||
  Fly  1117 VDVISTSKARGQVEKWLLELEIDMKKSVHHKVSEAFYSYLKMLRHVWVLTWPGQCVQSISLTYWT 1181

  Fly  1800 TETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTI 1864
            .|..:.|...:.: ||..| |.:|.:.|:|.::.|:.|||....|..:..:..:|||:|||:..|
  Fly  1182 LEITECFESEEPK-ENLAK-YLQKCVLQINKIVDLVRGDLNTQNRITLGALVVLDVHARDVLAEI 1244

  Fly  1865 IAKKVEVQTAFQWQSQLRHRW-DPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLT 1928
            :|.:||....|||..|||:.| |..:|   ..:.:....|.|||||||||||:||||||||.||.
  Fly  1245 VANQVEDLQDFQWLCQLRYYWEDNNLD---TRMINCSLPYGYEYLGNTPRLVVTPLTDRCYRTLF 1306

  Fly  1929 QSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFD 1993
            .:|:|.:||||.||||||||||||||.:|:.....|||||:.:||.::|...||||..|||.|||
  Fly  1307 AALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFD 1371

  Fly  1994 EFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLK 2058
            |||||.:|||||||.|:..||..|.|...|..|.|..:.|..|..||||||||||||:|||:|||
  Fly  1372 EFNRIDLEVLSVVAQQILTIQRGINSGSPTLVFEGTTLTLDPTCAVFITMNPGYAGRSELPDNLK 1436

  Fly  2059 ALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLV 2123
            ||:|..||:|||:||||||.|.:.||..|:.|:.|.:..|.||.|.||.|.|||:|:||:||||.
  Fly  1437 ALFRSVAMMVPDYALISEIELYSYGFLTAKPLSVKIVATYRLCSEQLSTQCHYDYGMRAVKSVLK 1501

  Fly  2124 VAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKR 2188
            .||||:...|...||.:::|:::|.|:||.:..|:|:|.|:..||||...:     ||.:.|:..
  Fly  1502 AAGALKLRYRDENEDILVLRSIKDVNLPKFLNQDIPLFQGITSDLFPGTVL-----PEADYVLFN 1561

  Fly  2189 SALDLKLQPED----GFIL-KIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQ------NQ 2242
            ....:..:.::    .|:| |:.||.|:..|||.:.::|:...||:..::.|.:..:      ..
  Fly  1562 KCTQMACERQNKQCTPFVLEKVQQLYEMIVVRHGLMLVGYPFGGKTTTYRVLAEALECMEKTDGS 1626

  Fly  2243 KRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIE 2307
            :.|..|..:||||:|..:|:|..:..:.||.||:.::..|..|.......||::.||.:|.:|||
  Fly  1627 ENKAIYTVINPKAITMGQLYGQFDAVSHEWSDGILAVNYRIFAISDSPDRKWLIFDGPVDAIWIE 1691

  Fly  2308 SLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSW 2372
            ::|||:||||.|.|.|.|.|.|:....|:||...|..|:||||||.|::|:.|..|||.|.:.||
  Fly  1692 NMNTVLDDNKKLCLMSGEIIQLSNTTNLVFEPMDLEVASPATVSRCGMIYLEPSSLGWEPLVASW 1756

  Fly  2373 LGT-----RTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMT------CYLLDSM 2426
            ..|     .|.|.:  ::::|..::.|.||.|.|..|:.|.|.|| |.|.::      |: :|..
  Fly  1757 KNTLPAAFHTVSKQ--LISMLISRFCPILLFILRKSLKEIAPTSD-ANLMVSLMNFFECF-IDDF 1817

  Fly  2427 LTPQNVPNDCPKDW---YEIYFVFCIVWGFGSSLFQDQIIDWSNE-------------FSKWFLN 2475
            ...:.|.|....|:   .|..|:|..:|..|.||..|     |.|             |.:...:
  Fly  1818 RDEKYVANVSDLDFRAQTEGIFLFSCIWSLGGSLDAD-----SREKFNIIFRALMEKTFPQSLYD 1877

  Fly  2476 EY------------KAVKFPL--SGTIFSF-YIDHETKKFFPW---TNLVPQFELDMDLPLQSNL 2522
            .|            |...||:  .|::|.: ||.....|:.||   .|..|  .:..|:|:...:
  Fly  1878 TYGVPEDLYVESLAKPFIFPIPKQGSVFDYRYIKEGKGKWKPWQDDVNSAP--PIPRDIPVNQII 1940

  Fly  2523 VNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTI-LMNAKLSALPSDKYSVTNVPFNFYTTSEM 2586
            :.|.|:.|:...:|.|.....|:||:||:|:||:: :::..|..:....|....:.|:..|::..
  Fly  1941 IQTNESVRIGAVLDLLNRHGKPIMLVGPTGTGKSVYVIDYMLKKMDLSFYKPLLISFSAQTSANQ 2005

  Fly  2587 LQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK-- 2649
            .|.|:...|:|:....:||..|.|.:.||||::||..:.|....|..|:|..:|:..||||:.  
  Fly  2006 TQDIIMSKLDKRRKGVFGPPLNSRFVIFVDDVSMPLKENYGAQPPIELLRMMLDHMMWYDRKNIV 2070

  Fly  2650 -MTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKF 2713
             |.|.|:..  |||...||.|: |:.||.||.|...:::..:.|.|..|.:.|:..|:|.  :.|
  Fly  2071 PMKLIDLQM--IVAMGPPSTGN-TVTPRFQRFFNVISIDDFNNDILNTIFSKIVLWHLDT--RGF 2130

  Fly  2714 DKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIR 2778
            .|......:.:|...:|::.....:.|||..|.||.|||||.:.:..|||.|..|...:.|.|.|
  Fly  2131 SKEFDPCIDEIVGATLTIYNDAKLNLLPTPAKSHYLFNLRDFSRVIQGVLLSVPEATEDVNSMRR 2195

  Fly  2779 LWIHECYRVYGDKLVDYTDIN-SFKKIVSDI---------------VRKGIEGVNDDVVYAQPLI 2827
            ||:||..|||||:||:..|.: .|:.|.|.:               |.|.......|.   :.||
  Fly  2196 LWVHEVLRVYGDRLVEDADRSWLFENICSTVKSCFNTDPSRLFGRLVEKDKSLQESDF---RQLI 2257

  Fly  2828 YCHFAKGLTDIK-YMPISGWDRLKSLLDEAQDRYNDYI-GAMNLVLFDDAMSHVCRISRILESSR 2890
            ||.|.....|.| |:.:...:.|:.:::.....||:.. ..||||||..|:.|:.||.||::..|
  Fly  2258 YCDFTNPKADTKNYVEVQDLEELRRVVEAYLVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQPR 2322

  Fly  2891 GYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMT 2955
            .:||||||||||:||||||||.|...::||:::|:.|...:...:|..:..|.|.......||.|
  Fly  2323 SHALLIGVGGSGRQSLTRLASHICDYELFQVEITRLYGPYEYHEDIKAILRKIGASEMHGVFLFT 2387

  Fly  2956 DSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQ-LGIVDNREN----------- 3008
            |.::..|.||..:::||.||::..||.::|        :.||:: :..:|.:.:           
  Fly  2388 DVQIKDESFLEDISNLLNSGEVPNLFTNEE--------KIEVQEKMAQIDKQRDKAVQTDGSPVA 2444

  Fly  3009 CWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLS--E 3071
            .:.:|:...:..|.:||..||:|..||.|.||||::|||.|||||..||:.||.:||.|||:  :
  Fly  2445 LFNFFVTTCKDQLHIVLAMSPIGDALRNRIRKFPSIVNCCTIDWFQSWPEDALLAVSTRFLASED 2509

  Fly  3072 ITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLD 3136
            :|.|.:..|:.:.  |.| |.:..::|..:.:...||||.||.|:||||..:..||.:|.....:
  Fly  2510 LTALERRTAIDMC--MEF-HTSTQELSAKFFSRLHRYNYVTPTSYLELIQTFKALLSQKRNNITN 2571

  Fly  3137 RRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLI---IVVGTENEKVSKER---- 3194
            .|.|...|:.:|....::|..:|:.|...|.:||    ||..::   :...|.:.|:::|:    
  Fly  2572 NRNRYLTGISQLDIAAQQVAVMQEQLIALEPKLK----EASEIVAEQVAKVTADSKLAEEQREIV 2632

  Fly  3195 ---AFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDA 3256
               ..|:||:..|.|..:|.      |:....:|.|.|.:|..|||||...::..:|:..|||..
  Fly  2633 KLDESAAKEQAAVAQEIKDE------CDAKLGEALPILESALAALNTLTTADIAVVKTMKSPPIG 2691

  Fly  3257 VVSVCGAVLVLFSSK-GKIPK-------DRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKAL 3313
            |..|..||.:|...| .|:|.       :..|...:..:.:: ||||:|:|:||.:|..:|:|.|
  Fly  2692 VRIVMEAVCILKDVKPDKVPNPSGLGTVEDYWGPSKRVLSDM-KFLDSLLNFDKDNIPVEVMKKL 2755

  Fly  3314 QPYILDAE-FSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTA 3377
            ...||..| |.|:||.:.|:|..|||.|||.:.::..|..:|.||:.||.|:|.....|...|..
  Fly  2756 AQRILSNEAFDPDKIKSASTACEGLCRWVIALTKYDVVAKIVAPKKLALAEAEATYNAAMKTLNE 2820

  Fly  3378 LNLRLTELEEQLNALQMEYDE-------ALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWM 3435
            ....|.::|..|.|:|...||       .||:.:.|..:..:       |..||.||..|:.||.
  Fly  2821 KLAMLAKVEANLAAIQKILDEQLRQYGILLAEHEACTKKLQR-------AQELISGLGGERTRWS 2878

  Fly  3436 ESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEM 3500
            |:.|:|....:.:.||:||.|..:||:|.||..:|.: |.:.|:....|             |.:
  Fly  2879 ETAKMLQASFKSVTGDVLISSGVVSYLGPFTIDFRVD-QIRKWVTKCLN-------------FGV 2929

  Fly  3501 IC-----------DDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYG 3553
            .|           :..:|..||..|||:|..|.|:|.::..:.|:|||||||.|..||:|. :..
  Fly  2930 TCTADFQLAVVLGEPVEIRFWNICGLPTDAFSIESAIMMKNARRWPLMIDPQGQANKWIKNYEKN 2994

  Fly  3554 TGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVL--KIGDREID 3616
            ..|.|:||:|.:|...:|.|:..|..:|:|||||.:||||..:|.:.|.|:|..|  |:||..|:
  Fly  2995 NKLCVIRLNQADYTRVMENAIQFGLPVLLENIGEELDPVLESVLQKTLFKQGGALCIKLGDSVIE 3059

  Fly  3617 FNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQ 3681
            :|..||..:.|||.||||.||:..:.||:||.:|..||:||||...|..|||||||.:..|..|.
  Fly  3060 YNHSFRFYMTTKLRNPHYLPEVAVKVTLLNFMITTQGLQDQLLGITVARERPDLEAEKNNLIVQG 3124

  Fly  3682 NHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREA 3746
            ...|..||..||.:|..|||| :|:|||.|.|..|...|..|::|..|....:.|..|||.||.:
  Fly  3125 ADNKRMLKETEDQILEVLSSA-ENILEDETAVQILSSAKALANDISEKQVITEATEKQIDIARLS 3188

  Fly  3747 YRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSF 3811
            |.|.||.::|::|.:.:|..|:|:||:||..|..::.:::......:.:..|:.:|.:..|:..:
  Fly  3189 YVPIAEHSTILFFTIVELANIDPMYQYSLVWFVNLYMSSIDNTEKVDDIAARLLDLRNHFTYSLY 3253

  Fly  3812 VYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFL------LRFPYMPNQTSNFTWLTHVGW 3870
            |...|.|||:|||:|...|.|.::.:...::..|..||      |..|| .|.|   |||....|
  Fly  3254 VNICRSLFERDKLLFSLILNINMMKHDNRIDNAEWMFLLTGGVGLENPY-KNPT---TWLGVQNW 3314

  Fly  3871 GGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESP-ENEKFPGEWKGK-SAIQRLCIMRCIRPDR 3933
            ..:..|.|...||||.:|...:..:||.|.||:|| :|:..|..|..: |..|:|.::|..|||:
  Fly  3315 DELCRLTNLTNFKGLREDFNENSAQWKPFFDSKSPQDNKDIPKSWDNRVSVFQKLLLLRVFRPDK 3379

  Fly  3934 MSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDH 3998
            :..|:.:|:..:||.:::|....:...:|.:|.....:.|:|:||.||...:.|..:..||..: 
  Fly  3380 LVPAVLNFVSGELGERFVDPPQFDLMASFADSHCCVPLIFILTPGSDPTATLLKFAEDQGFGTN- 3443

  Fly  3999 ENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSN-VHTSYRLFL 4062
             ...|:||||||..:|...|:...:.|:||:|||.||.|.::|.|||..|:.|.: .|..:||:|
  Fly  3444 -RLFSLSLGQGQGPIAMKMIDEGVKMGNWVVLQNCHLAASFMPLLEKICENLLPDATHPDFRLWL 3507

  Fly  4063 SAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKAL--DNFSD-ETLEMCSKETEFKAILF 4124
            ::.||..     .|..:|::.||:|||||.|:.:||.:::  |..|| |..|.|::...||.:::
  Fly  3508 TSYPADH-----FPVVVLQNGIKMTNEPPKGLRSNILRSMISDPISDPEWYESCTQPRIFKQLIY 3567

  Fly  4125 SLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGH 4189
            |||:||||:.|||.|||.|||..|.||..||.||:..|..:|.....|.::.||||.||..|||.
  Fly  3568 SLCFFHAVIQERRYFGPIGWNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGR 3632

  Fly  4190 ITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTG------------YHNYIDDNLP 4242
            :|||||||..:|.|::|..|.:||.|..|        .|..||            |.|:..|...
  Fly  3633 VTDDWDRRTLKTILDKFYCPAVIDLETPY--------YLDETGLYYVPVFKEVDLYLNFTRDLPQ 3689

  Fly  4243 SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSS----GGETVSQEDIIKNIIEDILD 4303
            ..:|:::|.|:||:|  :....|....:...|..:.|..||    |.:.::.|:::.|:..||||
  Fly  3690 ISAPAIFGFHANADI--MKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILD 3752

  Fly  4304 KTPTPFNILELMGRVEDRSPYII------------VAFQECERMNNLMTELKRSLNELDLGLKGE 4356
            |.|..|          ||...::            |..||..|.|.|:..::.||..|..|:||.
  Fly  3753 KLPKLF----------DRDAALLKYPTLYHQSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGL 3807

  Fly  4357 LTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAG 4421
            :.:|..:|.:...:.:.::|..|...:|||:..|.|:.:|.:.||..|:.|. |...||:.||:|
  Fly  3808 VVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHWF-DHGAPSTFWLSG 3871

  Fly  4422 FFNPQSLLTAIMQQTARKNEWPLDRMCLNCDV--TKKWKEELTTAPREGAYINGLFMEGARWDMK 4484
            ||..|:.||...|..|||....:|.:..:.:|  .::.:.:..:.|.:|.::.|:|:||||||..
  Fly  3872 FFFTQAFLTGAQQNYARKYVISIDLLAFDYEVLTVEEPQRQGLSGPEDGVFVYGIFLEGARWDRT 3936

  Fly  4485 MGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLR---------GPTFVWTFNL- 4539
            ...:|::..:|||..||::::|.:.:.....::.|.||:||...|         ...||....| 
  Fly  3937 GKYLAESRPRELFDTMPLIWLKPLKRVDLPERHNYLCPMYKTAERRGVLSTTGHSTNFVVAMLLL 4001

  Fly  4540 -KSRERASKWTLAGVCLLLQ 4558
             ......|.|.:.|..||.|
  Fly  4002 CNPNTPVSHWIIRGTALLCQ 4021

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 58/314 (18%)
DHC_N2 1368..1770 CDD:285579 116/413 (28%)
P-loop_NTPase 1903..2132 CDD:304359 142/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 50/141 (35%)
P-loop_NTPase 2510..2783 CDD:304359 89/277 (32%)
P-loop_NTPase 2860..3127 CDD:304359 108/282 (38%)
MT 3140..3480 CDD:289543 114/366 (31%)
AAA_9 3509..3722 CDD:289547 100/216 (46%)
Dynein_heavy 3864..4549 CDD:281078 243/732 (33%)
Dhc36CNP_523591.2 DHC_N2 750..1152 CDD:285579 116/411 (28%)
P-loop_NTPase 1281..1507 CDD:304359 142/226 (63%)
P-loop_NTPase 1595..1737 CDD:304359 51/142 (36%)
P-loop_NTPase 1933..2200 CDD:304359 89/272 (33%)
P-loop_NTPase 2299..2562 CDD:304359 106/274 (39%)
MT 2579..2921 CDD:289543 113/361 (31%)
AAA_9 2950..3164 CDD:289547 100/215 (47%)
Dynein_heavy 3304..4012 CDD:281078 246/739 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93171054
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.