DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dhc1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001342921.1 Gene:dhc1 PomBaseID:SPAC1093.06c Length:4196 Species:Schizosaccharomyces pombe

Alignment Length:4587 Identity:999/4588 (22%)
Similarity:1802/4588 (39%) Gaps:945/4588 (21%)


  Fly    62 INSGGQLYPSYSFPVRP--------RYKVA-YFIRYLTPLHLTDENM--LNSLLIGDLLPNPLAN 115
            |..||  :.|...|.||        :|.:: ||..||....:.|.:.  |||       |:....
pombe   130 ILKGG--HKSNEIPERPINAIFLYTKYVMSCYFTAYLAMESVDDRSTIDLNS-------PSKGKE 185

  Fly   116 LSILCDE--------VFF--------------PLLNNTVNQVGWTNVIANDMKTESQEMRNGIAQ 158
            |.:.|.:        .||              ||:.:|:..                      |:
pombe   186 LELTCQKFADFERSFTFFCREYQNSDTILQHHPLILSTIKH----------------------AE 228

  Fly   159 MKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEK 223
            ...|.::..:.|..:..|....                  .||..:|..||.:...|:      |
pombe   229 ENNLDLSVRLLPSKVLSDSEFY------------------KSLSNLVNVWLKTTRSLI------K 269

  Fly   224 IYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLE------KIQSIFEHSYRRIVE 282
            ::..:........|:||:....:|..|.:||..|.:.   |||:      :..:|...:....::
pombe   270 LFHDQISKTALEEFNFWQFYYRSLSRLNDQLHSRPVL---FVLDILAFGKRFHTIASFNSETNIQ 331

  Fly   283 LVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLV-------WGHSRYFHTL 340
            ..::.:.:...:.|.:|     :|.|.::      |.:..|.|:..|:       |.::.|..| 
pombe   332 CFVDKVGKIDALFKEIS-----LDIFLSS------STLESLQLSAALLYSTFSKKWRNTGYPET- 384

  Fly   341 NNMTLFFNLFHNSLIDCVNRTVEP-DSIFQGDVDEAYK-KLDINMQHLEYYKL------------ 391
             .:..|.|.....|:..::|.:.. .::...:||.::: .:..::..|.|.:|            
pombe   385 -RVLDFINFITEDLLKLISRLLPALGALSLSNVDFSHRTAVSSDILSLCYIRLKDFLRISGSLKE 448

  Fly   392 --IYNECRNSLK-------KFKIGTTFNSQDWTWHQDEIFGRLDK-----FLVRLEELKDL---- 438
              .|...:||:|       |.|...:|:.:    || ::.|.|.:     .|..||.|:.|    
pombe   449 EQSYYGLKNSIKQIKAFENKLKYIQSFHEK----HQ-QLIGALSEVYGLTHLTELEILEHLNKKE 508

  Fly   439 --FNTVRDFQKLEKI-VMG-GLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAE-NSLFQR 498
              ||.:..|:.|:.: |:. .|||.....:||      .|.|...|.::...|   |: .||.|.
pombe   509 HVFNILTVFKDLQSLNVLDISLKGVNAWNSLE------TSYYNCMTVLEDEVI---AQLKSLLQY 564

  Fly   499 DRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVK 563
            .:.|.:..|.:|.    ||               .|..|..::..:...:|::|:..::|:..:|
pombe   565 SKTSSQMFTTLMR----FQ---------------PLFFRTRVRTSISDCLHLLVNRIKQELDLLK 610

  Fly   564 KEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVS 628
            ..|....:....:.:|||..   .|..|.||.:..:|::|:      ||             |..
pombe   611 TRFTEDVSDTELIAMNELRN---LPMASSAIIWATQLKNRL------HE-------------YTK 653

  Fly   629 DIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDEANE-----LRVNFTERLIFALKD 688
            :|..|..::.::|....  :..|||.. :|:.:...||..:..|:     |..:|..::.:..:.
pombe   654 NINIIFGEDWNNFPDGF--ELKVECIT-LQKRLDTNLIFTNWINDVSSRNLNFDFDSKIFYLTQS 715

  Fly   689 IKVVRLLGCDVSVNLTK-FFCRE------------DELWQARVKLMRI----------AEWYND- 729
            ......|...||::... .||:|            .:|.:....|.||          .:.:|| 
pombe   716 ESAESPLRLSVSIDFDPCSFCKEIRTLAHLGYNIPSQLMELASCLQRIQLIAMCLIDSVQSFNDV 780

  Fly   730 TFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAF--------------SQRFIVMIFKMVKYL 780
            :||.:...|:|.:..|..|...|......||.||.|              .:.|:       |.:
pombe   781 SFEISKTEEERFLLQEYELAVRQHIVTGLFISWNDFIVGNLSTPPKCAIGKRNFL-------KNI 838

  Fly   781 HDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPAL------LLHTDPREPILSIRAANAADTQR 839
            |       .|:|.......|...:.:.:|..::...      |...|..|....|........|.
pombe   839 H-------PNVENYAYQFSSLTSLLMNKRNAISHTYMQIQEQLFQLDICEYSGDIFLTIQRKLQD 896

  Fly   840 LIDLLMYVNLKLFFDIPRRYS-LPPGEHGEEDEESDGIWPPIISLSVMTSVKFKK--KREVI--- 898
            ||||| |||         .|| |||..........|        |.:....||..  |..::   
pombe   897 LIDLL-YVN---------GYSNLPPFVRALNLRFQD--------LLISRCRKFLSFFKTTILTSG 943

  Fly   899 DEEDDLE-EFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSS 962
            :|.:||: :|..:.             ||.|:|..:.                         |:.
pombe   944 NENNDLKSKFSSDM-------------YEKLRGFLKP-------------------------TNL 970

  Fly   963 TYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSL-LKRV 1026
            |..|    |..|.:.|::.                   .|....:.::..|..:.|:..| :|..
pombe   971 TIQR----NIIEFDPPVYR-------------------KKEDSIYLLDMCLQSVVNIPLLSIKTT 1012

  Fly  1027 AQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYL 1091
            ||     .|.....|:..:        .|:|  ::|....:::..|....:.:.:.|        
pombe  1013 AQ-----RNCTLIGFFPVI--------NRLE--SEILGIFESLLFHFDSILGYQNYW-------- 1054

  Fly  1092 SEVKKF----GRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYE 1152
            .:|:.|    ..||.|.....:.|            :...||:|      .|.|:.::.......
pombe  1055 KKVEPFLNLNSLNLLLKSELFQLD------------QCYSLSLY------LIHLKSEVDEIGKVT 1101

  Fly  1153 DFFVFLRLNMTGFKVAVLSQVGQWI-SLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFE 1216
            ||.:| .:|.|.||..|...:.:|| :||........|.|...|.:..|..:.:..::...::.|
pombe  1102 DFKIF-SVNNTEFKSQVYLYLREWINALFDRFTFLLGKESEHLLNELDDTHSSLSTVDFTVNNTE 1165

  Fly  1217 GLVKILSVLNQ---------------------INEKQCIYDSMFDPLKEII----DLLRQYN--- 1253
            .|:..|.:..:                     .|:.....:..|..||:|.    |||..:.   
pombe  1166 SLINSLKIFKKAGCYKLNVEHKIITYQNYEMTFNDCDAFSEFNFSLLKDITSKWKDLLESFECRR 1230

  Fly  1254 ---YEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANT-----Y 1310
               ...||..|...:|.      .||:...|..||:...:..:.||:...   |..::|     :
pombe  1231 LKLENNKDEILRNFSEF------AKRVNTETLSLISEWCASSLSLIKANY---DEFSSTVDDFLF 1286

  Fly  1311 RKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKL- 1374
            |....:::...|..:       :.|||:                 |::       |.|.|.::. 
pombe  1287 RFSKATEQCLMVKYI-------KKDLEI-----------------EIE-------ESCDFSIQTE 1320

  Fly  1375 -VKIMWDFAITIQSTIN---DWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEAS 1435
             :.:...|...|.|.:.   :.|.|.||..|...:..:.......|..:..:.:.::.|...:.|
pombe  1321 EIHLYKKFKDVISSNLEFIVEIKNTRWKLFDTATLSVQTTHQINALESVHTSFQHFKLFTNTKQS 1385

  Fly  1436 LKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEYEEEVKNIVDK 1499
            |..|......:.:|::..::..|||.|.:.||....:| :...:.|::.::|..:|..:..:::.
pombe  1386 LNQLKDCTLLLQKLKSCPLKPVHWISLFEITKSTEQLDFEKLLVSDILGIDLQAHESFITTLLNS 1450

  Fly  1500 SVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLK-------ASEELIETLEDHQGQLQNMAS 1557
            :|.|..:|.|..::.:.|....|        |.|..|       ..:|||:.:|.:...|..:.:
pombe  1451 AVVEANLENQFNEVHSFWKNSYF--------SFKSFKGRNYIVVGCQELIDAVEKNMDSLNLIKT 1507

  Fly  1558 SKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKE 1622
            |::....:..:...|:::....:.:..|.|:|:.|.:|.:||..|..|:..|||.:..|....|.
pombe  1508 SRHFKDGDMNITDLQSKMKIIVKFLNIWKEIQQIWTHLSAIFYESTYIQQLLPELAASFFNSSKT 1572

  Fly  1623 FKALLAQMNADRNVVRSTN-----RSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFV 1682
            :..|:..:.....:.:.:|     .|.:||...||...|.||       .|.|.:|....|.||:
pombe  1573 YMHLVTLLKERSYLYKVSNIPSLLESAAKLSTTLEDSKKSLL-------KYFELQRHKISRLYFL 1630

  Fly  1683 SSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLENCDC---S 1744
            ...||::::||..:|.::.:.:.|||..:..|.:.:.:.|..|....|..|.:  .:|..|   :
pombe  1631 GDDDLMELISNPCDPFVINKQIIKLYPGIRSLIVDTENTNINGCTTNEGNELL--FDNPICLLDN 1693

  Fly  1745 GKVEVWLNRITDKMRDTLRDQLKRSL----TFYDHKPRHV----WIFEWPAQPALVGTQIMWTTE 1801
            .:...|::.:...::.||......|.    .||.:|.|:|    |...:|:|..|:..:.....|
pombe  1694 TQPLHWISSLEPFLKATLFQLFSTSFQQIRDFYYNKSRNVFCKEWFLRYPSQITLLSLRCTLCHE 1758

  Fly  1802 TNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIA 1866
            .....|..   ..:|:.::....|:.|    :||..:...:.::|:..:....:|.::.||.:..
pombe  1759 IETGIADC---CLDAVFNFINDGISSL----VLLADENELSIKKKVTLMFNELLHFKETVGLLCK 1816

  Fly  1867 KKVEVQTAFQWQSQLR--HRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQ 1929
            ...   ..:.|..:::  :|.|...:.....:...:|.|.:||......:|.|.||..|:..|..
pombe  1817 NSF---NNYFWSREVKAFYREDHDDEAVVIKMFSLEFIYAFEYSELDDPIVYTDLTRNCFSVLLH 1878

  Fly  1930 SLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDE 1994
            |:...:||:|.||||||||||.|.:...||..|:||||....:||:|..|..||||.|.:.||||
pombe  1879 SIASNLGGSPIGPAGTGKTETVKAVSAYLGKNVFVFNCDNAFNYKTIQRILSGLAQIGTYICFDE 1943

  Fly  1995 FNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKA 2059
            |||:....||.::..::.||..:...    ..|.:...|.....:|:||||||.||.:||.|||.
pombe  1944 FNRLDSGTLSAISYDIQRIQSLVSHS----DGLCQSPILLDAPTIFVTMNPGYLGRFKLPSNLKK 2004

  Fly  2060 LYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVV 2124
            |:||..|..||...|.||:.::.||:|:.||::...:.:..|...||...|||:||||:|.|:..
pombe  2005 LFRPIWMGSPDNKKICEILFLSFGFKESSLLSQVLDSFFLCCSGSLSNCLHYDFGLRAMKVVIKA 2069

  Fly  2125 A----GALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDL--FPALDVPRKRNPE-F 2182
            |    |.|::.:....|.::|..|:|:...|.::..|:|:|.......  |||:......:|: |
pombe  2070 AKRIKGFLKKKNTICQELEILWYAIREVLYPSLIYQDIPLFFKAEESYFNFPAVKANAFIDPDNF 2134

  Fly  2183 EAVIKRSALDLKLQPEDGFI-LKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKP 2246
            |..|::: |.......:.:: |||:||.::....:.:.::|..|:|||::::.|.....|.....
pombe  2135 EVNIEQT-LSKNFFGNNQYLKLKIMQLYQMSEAYNGIILLGKTGSGKSQIFRILQSALLNIGIDC 2198

  Fly  2247 HYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNT 2311
            ....::|||:|.:.|||.:|..||||.||:|:.|:|...:.........|.|.::.|.|:|::|:
pombe  2199 IVYVISPKALTKESLFGSMNMDTREWTDGVFTKLLRKTRDSCYYKRYMFVFDDELSPEWVEAMNS 2263

  Fly  2312 VMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQD---LGWTPFIQSWL 2373
            ::||||.|||::.|||||...:::.||..|:.:.|.||:||.|::.|:..|   |..|..:.|:.
pombe  2264 LLDDNKTLTLSNGERIALQPYVKIFFEADSVASLTRATISRCGLICISNIDDNILSSTDKMLSFT 2328

  Fly  2374 GTRTN------SSEVSML--NVLFDKYVPPLLDI---FRTRLRSITPISDIARLQMTCY-LLDS- 2425
            ...||      :.|.|.:  .||.|:.:..|:..   |...|:.|...:. .|...|.| |||. 
pombe  2329 SGATNYPLGSSNDEFSTVFSKVLTDEVMMNLISSCYKFSVDLQHIMNFTK-QRFFTTFYSLLDQT 2392

  Fly  2426 --MLTPQNVPND------CPKDWYEIYFVFCIVW---GFGSSLFQDQIIDWSNEFSKWFLNEYKA 2479
              .....|:...      |  ::.:....:.:.|   |...:..:::...|..:.:...|.|.|.
pombe  2393 KLFTRSSNITESLSFKELC--NYLKKKICYILAWCCTGDTDAKSRERFTHWLMQNASVDLPEIKD 2455

  Fly  2480 VKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSN-LVNTAETTRLRFFMDTLIEADH 2543
            .:..   :|..|.:..||:.::|   :..:......|....| ::.|.:|.|...|::..:..:.
pombe  2456 FEHV---SILDFDVSLETQSWYP---IAGKTLKSSALKYAGNTVIPTLDTVRYAEFLNFSLTKNR 2514

  Fly  2544 PLMLIGPSGSGKTILMNAKLSALPS-DKYSVTNVPFNFYTTSEMLQRILEKP--LEKKAG----- 2600
            .::..||.||||::||   |..|.| ....|..:.|:..|:|:.:...||:.  ..:..|     
pombe  2515 CVIFCGPPGSGKSMLM---LGTLRSRQDVEVIALNFSISTSSKSVVSFLEQSTVYYRSTGMTIMC 2576

  Fly  2601 -RNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYH-HWYDRQK--MTLRDIHKCNIV 2661
             :|:    .|.::.|.|::|:|.............:|..:::. .|:...|  :|:::|..|.  
pombe  2577 PKNH----EKVLVLFCDEINLPRSRNCLAEDVICFLRHMLEHQGFWHPLHKEWVTIKNIFVCG-- 2635

  Fly  2662 ACMNPSA--GSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENM 2724
            || |||.  |......|..|......|:.|...:|..|.|::|.:                    
pombe  2636 AC-NPSTDIGRNDFPERFLRRTVLIFVDYPESYSLVTIYNALLEK-------------------- 2679

  Fly  2725 VTTAITLHLKVVSSFLPTAIKFH-------------YNFNLRDIAN---IFTGVLYSNSETCPNS 2773
             :..|..:..::.:.:..::||:             |.:..||:..   .|.....|.:||  |:
pombe  2680 -SALINQYKTIILNIVKASVKFYQVLRENFKSSTQGYVYTPRDLTRWLISFKNYAESYAET--NN 2741

  Fly  2774 NQMIRLWIHECYRVYGDKLVD---------------YTDINSF-------KKIV-SDIVRKGIEG 2815
            ..:|::|.||..||..|:||.               .||...|       |:|: :||::.|:| 
pombe  2742 LSLIKVWYHEACRVLLDRLVSQKECSWGMTELQKVIVTDFGEFEVSVIFEKQIIFTDILKNGLE- 2805

  Fly  2816 VNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGA---MNLVLFDDAMS 2877
                        :..||                  ||..:.:..|..:..:   ..||..|:.::
pombe  2806 ------------FLDFA------------------SLRPKLESLYKKFYSSHPNNTLVFVDETIT 2840

  Fly  2878 HVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMK 2942
            |:.|..|||.:|..:|||.|..|.|::::.....:::|..:|::|..:.||:.|.:.|:.::.:.
pombe  2841 HILRFHRILNNSGMHALLQGSVGLGQKAVVEFVCWLNSFSLFELQKNQTYSIEDFEDNLKSILIL 2905

  Fly  2943 AGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDD---EVENIVNAVRNEVKQLGIVD 3004
            ||......|..:.:|......||.|:|:||.:.::...|..:   |::..:|.: ||.:.|.. |
pombe  2906 AGTTNCKACLAINESIAGVPGFLDLLNNLLTNSEVSNFFDQNDWAEIKKNLNKL-NEFQPLKF-D 2968

  Fly  3005 NRENCWKYFIEKV-RSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRF 3068
            :.|:..:.|:..| ::|..|...::......:..|.. |||:|..|||::|.|...::..::...
pombe  2969 SEESVTEIFMNNVFQNLCVVFYVYTSADVDFQTNSLS-PALLNRCTIDYYHSWDYHSMLQIANEV 3032

  Fly  3069 LSEITVLPKELALPVSN-----------FMAFVHKTVNDISKLY--LANAKRYNYTTPKSFLELI 3120
            |.|...|.   ||...|           :.|.....||..:.:.  ..:..:.:|.:...|:..:
pombe  3033 LQETISLN---ALDHDNPNLKNIKGSSIYDAVAQAVVNTHTSIVWEFKHLGKTSYFSCLHFIRFL 3094

  Fly  3121 ALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEA-DNLIIVVG 3184
            ..:..:...........:.|:|||..|:...::.:|..::.|..|:..|..|.:.| |.|..::.
pombe  3095 NTFCLIFGRDANKLSKEKSRIENGFKKIKETSQGIDKFKEALSDQQNVLFSKTKTANDRLQCIIQ 3159

  Fly  3185 T----ENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLT 3245
            |    |.:||...:|.||.::|:..     :..|.....::...|:||:|.|:::::.:.|.:|.
pombe  3160 TKQAVEAKKVYSLQAEASLQKKSFL-----LNEKKNSVMKEVSYAKPAVIEARKSVSDIKKAHLI 3219

  Fly  3246 ELKSFGSPPDAVVSVCGAV--LVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYD-KKHIHP 3307
            ||:|...||.|:......|  |:.||:       ..||..:..:.. |.|:..::||: :|.:..
pombe  3220 ELRSLSRPPMAIRITMEVVCKLLGFSA-------TDWKNVQQLLKR-DDFIPKILNYNLEKELSI 3276

  Fly  3308 DVIKAL-QPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEP--------------K 3357
            ::.:.: |.|..:..|:.:.:...|.|...|..|:.:|..:..|...:||              .
pombe  3277 NLRRKIEQDYFSNPIFTFDSVNRASKACGPLLLWIKSICNYSKVLEKLEPLNSEVDRLKLEQKNA 3341

  Fly  3358 ERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANR 3422
            |..:.|:....||..:||..|......:..::::::::.||...|.|:          :|::   
pombe  3342 EECIQETIAACKDLDEKLLQLQEEYASMISEIHSMELQMDEVKCKMQR----------SIEV--- 3393

  Fly  3423 LIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQP 3487
             |..|:.|:..|...:.:....:..|.|:.|:.:.|:.|.|....:.|..|:.|. .|...:...
pombe  3394 -ITDLSIERNEWSGFLNLYPKRMWNLVGESLMEASFVVYAGNLDPSMRIFLRNKC-EPIISSFGF 3456

  Fly  3488 PIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKY 3552
            || |...|......|....|.....:.|..  .|.||..|:.:::...|:|||..|.:..:.:.|
pombe  3457 PI-SKSAVRTNIERCVQTSIESKYYKNLTD--YSLENIYIIQENKSPLLIIDPSSQILDILPSLY 3518

  Fly  3553 -GTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREID 3616
             |....::..|.:::.:|::.|:.:||.::|:: .|..|..:.|||..:..       .|..|:.
pombe  3519 KGKASDLISFSNKSFQNQIKLALLSGSAIIIKD-AELWDVSIEPLLKPEFF-------TGSGEVQ 3575

  Fly  3617 FNSRFRLILHTKLANPHYKPEMQAQ---------TTLINFTVTRDGLEDQLLAEVVKVERPDLEA 3672
            .......|..|...|..:..|:|:.         ..::|||::...||.|:|..|:.|:.|.:  
pombe  3576 TTFAKDTITITLPLNIIFFSEVQSNELENKASKFMNVVNFTLSISLLETQMLKSVISVQEPGV-- 3638

  Fly  3673 MRTRLTQQQNHFKITL------KFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVA 3731
                ..|:.|.|.:.|      :.|::.||..|.|:.:|::....:|:.|:..|:..:.|.:..:
pombe  3639 ----FKQKDNCFTLKLSIERQIRSLQEQLLKTLCSSNENIVGTDEIVVLLKNLKEKHETIRLAYS 3699

  Fly  3732 EAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLK 3796
            |::....::|.....|:.:.:....:..:......:...|.||.......|:. ||..:...:.:
pombe  3700 ESQSINRKVDELIRRYKLSIKSFLSVVVVFQHFISLKKSYSFSFNFIWSTFHQ-MLNVVLENRNQ 3763

  Fly  3797 D----RVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPN 3857
            |    .::.|.|.|..| |:|    :|.:|:::||                    |||.|.:.|.
pombe  3764 DFKSLIMDALRDLIRRC-FLY----IFPEDRVLFL--------------------FLLMFFFFPK 3803

  Fly  3858 QTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKG------ 3916
            :|              .:|....:..|...::|.|   :..|.::.|..||:  |..:.      
pombe  3804 ET--------------ESLRKLLIVNGKTLELEQS---YLNFFETCSDSNER--GGLESLFFKTH 3849

  Fly  3917 KSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTF--------------EESSP 3967
            .|.||..|         ......:..||.......|..|..|...|              .||..
pombe  3850 ASNIQNFC---------TEVLANTHCEEDCLKLLYDLWSSAFKVEFSNIKYDFLKIINDESESRM 3905

  Fly  3968 ETHIFFVLSPGVDPL-------KDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYG 4025
            .|.::.:.:..:|.|       ::::||..|||.:   ||          |.:|::.:::||...
pombe  3906 PTIVYLMENCEIDSLLQNAKIPQNIKKLTVSLGSA---EN----------ESLADSYLKLASTEP 3957

  Fly  4026 HWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEP 4090
            .|:.:.||||...|...|..||.:.|   |.:.|:...:|     ..:.||..:|..:..|....
pombe  3958 LWLFINNIHLSTPWAEKLPSKMSNHL---HKNSRIVCLSE-----IHNQLPHQLLCISRSIVFNK 4014

  Fly  4091 PTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDL 4155
            .|....|:...|:..  .|:........|: :.|.|.:.||.:||...|....|.....|:..|.
pombe  4015 QTSFKNNLLNLLELL--PTMTHTLPHNRFR-LFFFLSWLHATLAEIYCFTCSSWKEPCYFDDSDF 4076

  Fly  4156 TISVYVLYNYLEANTRV---PWEDLRYLFGEIMYGGHITDDWD--------RRLCRTYLEEFMQP 4209
            .....:|.|.|..|..:   .|...:.|...::||..::...|        :||...:..:....
pombe  4077 YFGTKILCNILYRNVHLEEFSWGTFKDLLLNVVYGPKVSASSDFIALDKILKRLIAQFKTQISSN 4141

  Fly  4210 ELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESP 4246
            .|:....:    |..|..:.::.....| ..||.|.|
pombe  4142 ILLTDNFK----FILPYEITFSSAKEVI-GQLPDEIP 4173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 131/645 (20%)
DHC_N2 1368..1770 CDD:285579 91/423 (22%)
P-loop_NTPase 1903..2132 CDD:304359 96/233 (41%)
P-loop_NTPase 2217..2352 CDD:304359 49/135 (36%)
P-loop_NTPase 2510..2783 CDD:304359 64/304 (21%)
P-loop_NTPase 2860..3127 CDD:304359 66/287 (23%)
MT 3140..3480 CDD:289543 82/363 (23%)
AAA_9 3509..3722 CDD:289547 53/229 (23%)
Dynein_heavy 3864..4549 CDD:281078 86/422 (20%)
dhc1NP_001342921.1 DHC_N1 251..816 CDD:312031 132/645 (20%)
DHC_N2 1322..1718 CDD:312039 88/413 (21%)
DYN1 <1605..4196 CDD:227570 661/2801 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T631349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.