DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and kl-2

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001015505.5 Gene:kl-2 FlyBaseID:FBgn0001313 Length:4459 Species:Drosophila melanogaster

Alignment Length:4732 Identity:1422/4733 (30%)
Similarity:2330/4733 (49%) Gaps:592/4733 (13%)


  Fly    74 FPVRPRYKVAYFIR---YLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQV 135
            |||.|...:.||||   .:..:| :..:|:|...:.|.:...|  |.|| :.::.|:..|.:.  
  Fly    68 FPVAPVIDLCYFIRSSKEIISIH-SFHDMVNFGTVQDDVDGCL--LKIL-ELIYAPIFRNFME-- 126

  Fly   136 GWTNVIANDMKTESQEMRNGIA-----QMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNP 195
             |.:.:.....| |.:...||.     :|.|:    |:..:|..:.|:.:        :||..:.
  Fly   127 -WGDNVKQRFCT-SLDKFLGILTAIYFKMSGM----TVLYVPYVVKEIAK--------EISSYDR 177

  Fly   196 LMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIK 260
            ....:||.:.|.|...:..|:|.|.   :.|...:......|.||..|.|.|:.|..||....::
  Fly   178 EFVKNLECIAVSWATLIRILLNDKT---LTSPNEYISVGDEFEFWLYRFEVLQGLNAQLDQVDVQ 239

  Fly   261 TIGFVLEKIQSIFEHSYRRIVELVLES---LAEARDITKCLSPLKRKMDKFETNDMDENRSDIRP 322
            .|..||....|::   .::|.||:.||   |.||.:..|.|..|.:...:.:.::.....|.:.|
  Fly   240 QIIRVLRSTHSVY---IKQIDELIFESTHELMEAMENIKFLHLLMQPCSQLDFSESPTFVSQLIP 301

  Fly   323 LML-TIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHL 386
            ..: .|..:|.:|..::..:.:|..|....|.:|......|..:.|..|......|..::.:...
  Fly   302 RTIHLIRFIWLNSEQYNRRDLITGIFRNLSNQIIRFCTEKVNVEKILSGSSRFGIKICNMCIDCC 366

  Fly   387 EYYKLIYNECRNSLKK--FKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLE 449
            ..||.||:....:..|  .:||       |:.....||..:|.|:.||.::.|:..::..|.:|:
  Fly   367 LTYKGIYDIMSKTHAKINIRIG-------WSLDNAMIFNHVDAFMERLNDVIDICESMMVFGRLD 424

  Fly   450 ------KIVMGGLKGRQITFALEKILEEY----------------NSIYREWTN--IQYNPIDPD 490
                  |...||..|.:.....:.:..|:                |....||..  |:|      
  Fly   425 ESESIPKPQFGGTSGTEFEATADNVENEFLVTLTALCTDSKEIILNVHKNEWYEEVIKY------ 483

  Fly   491 AENSLFQRDRLSFKAKTDVMERMVSFQF------EKGLEDTHDLLLAG------SLLLRPI---- 539
                     |.:.::..:.::|::|..|      |:.||..:.::...      ...||.:    
  Fly   484 ---------RRTVQSMEETVQRLMSNVFQHICNVEEALESLNVMIFYSYRSTIRKTFLRQVSSAW 539

  Fly   540 --IKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALG-----------LNELPTDDCFPKVS 591
              ....::..:|:::|..:     :.:.::.: ....|||           .|.|.:.|..|.||
  Fly   540 VFFSNEIDSSVHMLMDRSK-----MHESWVPY-YASRALGYRVHLDRLVWLCNRLNSSDWLPNVS 598

  Fly   592 GAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQG 656
            .|...|||                   |::.|            :|.|...|...|:|...|...
  Fly   599 EASVVLKK-------------------FESVR------------REFDKEVKKSFDEWQKNCCSL 632

  Fly   657 I---QQDITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARV 718
            :   :.|..|.:..|.:...:..|....::...:..:....||..|...:.|.:.:.:.|.....
  Fly   633 LLNQKLDRYLLIRSKKKKGLIECNIDRTILTICEQAQHFERLGLGVPGMVRKIYEKHETLRFVYN 697

  Fly   719 KLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKY---L 780
            .::::...||.........|::|..|.:...:.::.|                .:||:. |   |
  Fly   698 SVVQVCLNYNHILSALSEQERKLFRALIQACDRKIAP----------------GVFKLT-YGGEL 745

  Fly   781 HDRLVA--------AQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADT 837
            .|..:|        .||.::..|.:|::   :..|..|..:          .|:|....:.|   
  Fly   746 SDAYIADCAKHTNKLQETMDIYKRAIQN---IARFCEKICD----------TPMLKFNFSGA--- 794

  Fly   838 QRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEED 902
                     |.:.:|                                                |:
  Fly   795 ---------VTISIF------------------------------------------------EN 802

  Fly   903 DLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAE-----NLVDSVI--- 959
            .|..:....|    .|:..|  |..:..|.   .|:|:|::..::::..|     |:.|.::   
  Fly   803 HLSSYLRRVS----NILRGF--YSTITDLI---FAVFKEFQAVIEDMPIEWYGFVNVFDDMLATA 858

  Fly   960 ---TSSTYLRMEVDNRYEN----NTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMN 1017
               :|...|.|..:..:.:    ..||..:..:::|..:|...::|.     .|..:...:|.::
  Fly   859 FLTSSKNSLNMLTNALHRDPDMAAAPILVMESDVRERCIVLTPDIDV-----IANLLSGYIDRIH 918

  Fly  1018 NMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSEL-DKQRVEIMNKIKLALQAVRVHGKGFMEFSS 1081
            |::....|:.     :....|.....|...|:.| |.:..:::..|:..:...|....|::.|  
  Fly   919 NILEQFPRIG-----IKMKLPKEHQYESFSKAFLEDSESTQLICNIEAEINHEREEIDGYITF-- 976

  Fly  1082 LWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIR 1146
               |:....|.|.               .:||.:..||...:   ...:::..::.:..:.|.| 
  Fly   977 ---WNSHRMLWET---------------TELEFTKRVKATQM---TADIFEASIEYYSAMADDI- 1019

  Fly  1147 TWETYEDFFV---FLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFV--DEANIVL 1206
               :|.|...   |:.:|....|.::|..:.:|.:|....|::...:.::.:..::  :|..:::
  Fly  1020 ---SYVDAITHVYFILMNQNYIKSSILDCIEKWQALNIKILLSHSFSLIRAIYRYMRKNERKMMM 1081

  Fly  1207 ------KIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQIN 1265
                  :..|.|..||      .::|::..||    :.|.|..|:..:|.:|..|..:....::.
  Fly  1082 VPRTLKESLLAKQFFE------RIINEVPLKQ----AGFPPTLELFAILDKYQVEIPEEIRVKVI 1136

  Fly  1266 ELPDAWMK-VKRLAATTKQLIAPIQSYQVDLIEK----RILLCDNMANTYRKKFLSKKFFFVP-C 1324
            .|..||.. :|||....:.|....:.::..|:::    :|:|         |:||...|..:| .
  Fly  1137 GLEAAWHHYLKRLGEADEMLDNNREEFKKILVQQAEKFKIIL---------KEFLDDFFLKLPTS 1192

  Fly  1325 LSCYELIDESDLELVALEER-----QRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAIT 1384
            .:....|....|.::||:..     :.||.....:|.:..|:.:.:....|::::||.:|:....
  Fly  1193 ANINPRIALKFLRIIALKIEDCFTFEESLMRDLAVFNVNQPESIDLRKLDFEVRIVKNIWELIFE 1257

  Fly  1385 IQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAM--RTWEPFIFMEASLKNL---MTSLR 1444
            .|:....|||..:.|::|..|:.......:|...|:|..  |.||   .:||:.||:   ..:|.
  Fly  1258 WQTNWEGWKKGYFWKMNINEMEDTALNLYKEFTTLNKKFYDRHWE---MLEATTKNVDSFRRTLP 1319

  Fly  1445 AVTELQNPAIRDRHWIELMQTTKVKFSMDDST-TLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEK 1508
            .:|.|:||.:|:|||..:.....|.|..:... ||:.:|:|:...:.|::::|.:.:..|:.:|.
  Fly  1320 LITALKNPCMRERHWNRVRDVIHVNFDENSKNFTLELIINLDFQAFSEDIQDISNPATMELQIEN 1384

  Fly  1509 QLRDIATAWGTMEFGTDI-HDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQ 1572
            .:::|||.|....|.... ||  .|..:|..|:..:.||:|..|:..|.:::::..|...|..|:
  Fly  1385 SIKNIATIWKKQSFEMAFYHD--GIYRIKNVEDCFQLLEEHMVQISAMKATRFVEPFITIVDYWE 1447

  Fly  1573 NRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVV 1637
            ..||...:.:.....|||:|.|||:||.| :|||.||||:::||..|.:||:.:.::|...:..|
  Fly  1448 KTLSYISETLEKGLTVQRQWLYLENIFQG-DDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAV 1511

  Fly  1638 RSTN--------RSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNG 1694
            ::||        ...|::.|.||::       ::||..|||.||..:|||||:|:.|||:||.|.
  Fly  1512 KATNLRPPPFLLNRFSRMDERLELI-------QRALEIYLEAKRQLFPRFYFISNDDLLEILGNS 1569

  Fly  1695 NNPALVARHLTKLYDSMGKLNLISGSK-----NAAGMVAKELEEYVPFLENCDCSGKVEVWLNRI 1754
            ..|.||..||.||:|::.||.|....|     .|:||.:.: .|||.|:......|..|.||.::
  Fly  1570 KRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMHSDD-GEYVEFMMVIYIDGPSERWLKQV 1633

  Fly  1755 TDKMRDTLRDQLKRSLTFYDHKP----RHVWIFEWPAQPALVGTQIMWTTETNDAF---AKVQQR 1812
            .:.|...:::.||  ||....|.    |..||..||.|..|...||.||||...:.   :.|.|:
  Fly  1634 EEYMLVVMKEMLK--LTRGSLKKLVGNREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQK 1696

  Fly  1813 YENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQW 1877
              ..|:...||||..|:.|..:...|||...|.|:.|:.|:::|.|||:..:.....:....|:|
  Fly  1697 --KPLRKLKKKQIKVLSKLSEMSRKDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEW 1759

  Fly  1878 QSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGP 1942
            .||||..|..:.:.|.....:.:..|.|||.||:.||||||||||||||||.:|||..||:|.||
  Fly  1760 FSQLRFYWHRESELCVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGP 1824

  Fly  1943 AGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVA 2007
            ||||||||.||||:|||:.|.|.||||.:||||||....||||:|.||||||||||::|||||||
  Fly  1825 AGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVA 1889

  Fly  2008 VQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFA 2072
            .|:..|..|:.:|.....|.|:.|.|:.|||:|||||||||||.|||:|||:::||.:|:|||..
  Fly  1890 QQIMSIMAALSTKALELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNI 1954

  Fly  2073 LISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPE 2137
            :|:|.:|.::||...|.||||..|||.|.|:.||||.|||:|||::.::|..||..||......|
  Fly  1955 IIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTE 2019

  Fly  2138 DQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFI 2202
            ::::..|::|.|:.::..:|:|:|.|::.|:||.:.:|.....||...|.....:..|||....:
  Fly  2020 EEIVYLAMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAV 2084

  Fly  2203 LKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTY--QNQKRKPHYN-----DLNPKAVTNDE 2260
            .|:::|.|....||||.|||..||.||..|:||...:  .|.:|...:.     .:||||:...|
  Fly  2085 KKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQRFSGWEAVTVYPVNPKALNLAE 2149

  Fly  2261 LFGIVNPSTREWKDGLFSILMRDQANLGGTGP--KWIVLDGDIDPMWIESLNTVMDDNKVLTLAS 2323
            |:|..|.||.||.||:.|.:||  ...|...|  ||::.||.:|.:|||::|:||||||:|||.:
  Fly  2150 LYGEYNLSTGEWLDGVLSSIMR--IICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVN 2212

  Fly  2324 NERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVL 2388
            :|||.:..::.||||:..|..|:||||||.|::|.:..|.||.||:.|||...........|.:.
  Fly  2213 SERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWLQRLRIKEFADFLRIH 2277

  Fly  2389 FDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPN----DCPKDWYEIYFVFCI 2449
            ||..||.:||..|.|.:.....:::..:...|.||:...|..|..|    :..::...::|:||:
  Fly  2278 FDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLEIFGTKVNGINPINLELLEEMTRLWFMFCL 2342

  Fly  2450 VWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPW-TNLVPQFELD 2513
            ||...||:.:|     |.:....|:.|.::. ||:..|:|.:::|...:.|.|| :.|:..::.|
  Fly  2343 VWSICSSVDED-----SRQRLDSFIRELESC-FPIKDTVFDYFVDPNERTFLPWDSKLLSSWKCD 2401

  Fly  2514 MDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPF 2578
            .:.|....:|.|.:|.|..:.:..|:..::|:||:|..|:|||....:.:.|...:|:.:..|..
  Fly  2402 FESPFYKIIVPTGDTVRYEYVVSKLLAEEYPVMLVGNVGTGKTSTAISVMEACDKNKFCILAVNM 2466

  Fly  2579 NFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHH 2643
            :..||:..||..:|...||:....:.|||.||||.|:||.|||..|.|.:..|..||||::||.:
  Fly  2467 SAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKY 2531

  Fly  2644 WYDRQKMTLRDIHKCNIVACMN-PSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMD 2707
            |::|:......:....::|.|. |..|..||..|.|..|....:..|||:.:..|..::|.|.::
  Fly  2532 WFNRKTQQKIYVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLCQKLE 2596

  Fly  2708 NPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPN 2772
            :    :...|.::...:....|.|::.::|..|||..|.||.||||||:.:|.|:|.|..|....
  Fly  2597 S----YPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISKVFQGLLRSEKELQNK 2657

  Fly  2773 SNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQ-PLIYCHFA--KG 2834
            .|..:|||:|||:||:.|:|||.:|...|...::||:.|..|.....:..:: |..:..||  :|
  Fly  2658 KNFFLRLWVHECFRVFSDRLVDDSDQFWFVNTINDILGKHFEVTFHSLCPSKVPPFFGDFAHPQG 2722

  Fly  2835 L-TDIKYMPISGWDRLKSLLDEAQDRYNDYIG--AMNLVLFDDAMSHVCRISRILESSRGYALLI 2896
            . .|::.      |.|::.:....:.||::.|  .||||.|.:|:.|:.||.|::...||:.|.:
  Fly  2723 FYEDLQV------DFLRTFMKNQLEEYNNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNM 2781

  Fly  2897 GVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAR 2961
            |:||||:|.||:||:||..:.||||::||.|...|.:.::..||...|:|.....|:.:..::|.
  Fly  2782 GIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAE 2846

  Fly  2962 EQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLC 3026
            ..||.:.|::|::|:|: ||..||.:.:...:....|:.|::...|..:.|||..||..|.|.||
  Fly  2847 VSFLEITNNMLSTGEIN-LFKSDEFDELKPELERPAKKNGVLLTTEALYSYFILNVRDFLHVALC 2910

  Fly  3027 FSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFL----SEITVLPKE--------- 3078
            |||:|...|...|::|||::.||.:||..|||:||..|:..||    ..:.|..||         
  Fly  2911 FSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVASHFLIGFPLNVVVSGKEDEKHRESLV 2975

  Fly  3079 ------LALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDR 3137
                  |...::...:.:|.:|..:|:...|..|||||.|..::|:|::.:.|||.:|.......
  Fly  2976 ISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTA 3040

  Fly  3138 RLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVV------GTE-NEKVSKERA 3195
            ..||.|||.|::...::|..:.:.||....::||..:|.::.|.::      .|| .|||..|..
  Fly  3041 SNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSEATEQKEKVDAEAV 3105

  Fly  3196 FASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSV 3260
            ...::|  :..:|...||:|     |.....|.:.||.:||:.|||.:::|:||:|.||..:..|
  Fly  3106 LIRRDE--IICLELAATARA-----DLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKV 3163

  Fly  3261 CGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPE 3325
            ..|||:|.   ||.|   :|:..:..:.. ..||::|.|:|:.||....:|.:..|..:.|..|:
  Fly  3164 MEAVLILL---GKEP---TWENAKKVLSE-STFLNDLKNFDRDHISDKTLKRIAIYTKNPELEPD 3221

  Fly  3326 KILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTE------ 3384
            |:...|.|...|..|::.|..:..||.:|.||:..|..:.|.:::.:..|.|...:|.|      
  Fly  3222 KVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIE 3286

  Fly  3385 -----LEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFG 3444
                 |||:.|.|    :|..||:::.:.:..:...       |:..|:.|:.||:|:|..|...
  Fly  3287 ELYRQLEEKTNLL----NELRAKEERLRKQLERAII-------LVESLSGERERWIETVNQLDLS 3340

  Fly  3445 IQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAE 3509
            .::||||.|:...|:||:|.|...||:||..| |....|:..  ||:|..:.....:.|...|.|
  Fly  3341 FEKLPGDCLLSVAFMSYLGAFDTKYREELLVK-WSLLIKDLL--IPATLELKVTYFLVDAVSIRE 3402

  Fly  3510 WNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLSQRNYLDQVERA 3573
            ||.||||:|.:|.||..|:.|..|:||:||||:|...|:|. :....|:.|.....:||.|:|||
  Fly  3403 WNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNMEERNQLMTLDFGMADYLRQLERA 3467

  Fly  3574 VSNGSVLLIENIGENIDPVLNPLLGRQL-IKKG-TVLKIGDREIDFNSRFRLILHTKLANPHYKP 3636
            :..|..:|::|:||.:|..:||:|.:.. |:.| .:||..|:.|.:|:.||..:.||::||||.|
  Fly  3468 LKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPP 3532

  Fly  3637 EMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSS 3701
            |:.::||::||.:.:||||.|||..:|:.|:|.||..:..|.......|.||..|::::|..|:.
  Fly  3533 EISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNE 3597

  Fly  3702 AGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFK 3766
            :..::|:|..|...|:|:::|:..::..::.|::|.|:||:||:.|:||:|||||::|:|.|:.|
  Fly  3598 SRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSK 3662

  Fly  3767 INPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLC 3831
            |:|:|.|||.|:.::|..::.::...:.:.:|::|:.:..::..:..|.|||||:.||:|...:.
  Fly  3663 IDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMT 3727

  Fly  3832 IQILVNLGEVEPTELDFLL-------RFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDI 3889
            .:||.|.|::...|.||:|       :....||...  .|::...|..|..|:..:.|.|:....
  Fly  3728 AKILSNAGKLLEEEYDFILKGGIVLDKLGQAPNPAP--WWISEQNWDNITELDKVSGFHGIIDSF 3790

  Fly  3890 EGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDA 3953
            |..:|.|..:..:..||.|...|||..| :..|::|::|.:||||:|:.:..||..|||.:|:|.
  Fly  3791 EQHYKAWNGWYATTFPEQEDLVGEWNDKLTDFQKICVLRSLRPDRISFCLTQFIITKLGPRYVDP 3855

  Fly  3954 RSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAI 4018
            ..::...||:||..:|.:.|||||||||.:.:..|.:|:..:   :..:|:||||||..:|...|
  Fly  3856 PVLDLKATFDESISQTPLIFVLSPGVDPAQSLISLSESVKMA---QRMYSLSLGQGQAPIATKLI 3917

  Fly  4019 EIASQYGHWVILQNIHLVARWLPSLEKKMESSLS-NVHTSYRLFLSAEPAGDPAAHILPQGILES 4082
            ....:.|:||.|.|.||...|:|:|:|.:.:..| .:|..:||:||:.|..|     .|..||::
  Fly  3918 MDGIKDGNWVFLANCHLSLSWMPTLDKMIATMQSMKLHKKFRLWLSSSPHPD-----FPISILQT 3977

  Fly  4083 AIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRS 4147
            :||:|.|||.|:.:|:.:..:|.::..:|.||:.:::|.:||:||:||.|:.||:||...|||..
  Fly  3978 SIKMTTEPPRGIKSNMKRLYNNINEANMENCSEPSKYKKLLFALCFFHTVLLERKKFLELGWNVI 4042

  Fly  4148 YPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELI 4212
            |.||..|..:|..:|..||......||..|:||...:.|||||||||||||..||:.:|...:.:
  Fly  4043 YSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQAL 4107

  Fly  4213 -----------------DGE----LEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAE 4256
                             ||:    |:..|.||           |:       :.|..:|.||||:
  Fly  4108 QTRKFRLSTLPNYFIPDDGDVQSYLDQIQMFP-----------NF-------DKPDAFGQHSNAD 4154

  Fly  4257 IGFLTTVSERLFR--IVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFN---ILELMG 4316
            |..|...:..||.  :..::|...|..:..|||.     :.::.::||..||...|   ..:::|
  Fly  4155 IASLIGETRMLFEALLSMQVQTNSTSSNENGETK-----VFDLAKEILMNTPDEINYEQTAKIIG 4214

  Fly  4317 RVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTK 4381
              .:|:|..:|..||.||.|.|:.::...|.:|..|::|.:.:||.:||:.:.:...:||.||.|
  Fly  4215 --INRTPLEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQWLK 4277

  Fly  4382 LAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDR 4446
             ||.|:..|.:|..||:.|:.....|....|.|...|||.:..|...:||::|.:||..:.|:|.
  Fly  4278 -AYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDE 4341

  Fly  4447 MCLNCDVTKKWKEELTTAPR-----EGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIK 4506
            :..:..|   :.||.|.|.|     .|.||..||:||..|..|...:.|....||...:||::.|
  Fly  4342 LSWDFYV---FVEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFK 4403

  Fly  4507 AVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKS-RERASKWTLAGVCLLL 4557
            .|...|:..:.||:||.|...:|..:||...:||| .|:|..|...|..|||
  Fly  4404 PVENLKKRCRGVYQCPAYYYPVRSGSFVIAVDLKSGNEKADYWIKRGTALLL 4455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 119/628 (19%)
DHC_N2 1368..1770 CDD:285579 135/422 (32%)
P-loop_NTPase 1903..2132 CDD:304359 143/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 65/144 (45%)
P-loop_NTPase 2510..2783 CDD:304359 90/274 (33%)
P-loop_NTPase 2860..3127 CDD:304359 103/288 (36%)
MT 3140..3480 CDD:289543 108/358 (30%)
AAA_9 3509..3722 CDD:289547 85/216 (39%)
Dynein_heavy 3864..4549 CDD:281078 243/719 (34%)
kl-2NP_001015505.5 DHC_N1 178..749 CDD:285571 124/653 (19%)
DHC_N2 1244..1646 CDD:285579 133/416 (32%)
P-loop_NTPase 1785..2015 CDD:304359 143/230 (62%)
P-loop_NTPase 2099..2242 CDD:304359 66/145 (46%)
P-loop_NTPase 2401..2668 CDD:304359 90/271 (33%)
P-loop_NTPase 2752..3030 CDD:304359 100/279 (36%)
MT 3043..3373 CDD:289543 107/356 (30%)
AAA_9 3402..3618 CDD:289547 85/216 (39%)
Dynein_heavy 3760..4447 CDD:281078 244/726 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93126950
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.