DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah5l

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_002666734.3 Gene:dnah5l ZFINID:ZDB-GENE-091204-287 Length:4667 Species:Danio rerio

Alignment Length:4826 Identity:1406/4827 (29%)
Similarity:2369/4827 (49%) Gaps:563/4827 (12%)


  Fly     2 ADEKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLN-NPNKKRIIF----- 60
            |.:.|::..:|:|..:..:.:.:.:.|...:..:.|..::...:|.||.: |.:|..::|     
Zfish   130 AFKDERRAALDSRHRYLISVIAEAISLADMEVEEAIIADDKFYMIEEFFSANGSKSLMLFYQATE 194

  Fly    61 TINSG--------GQ--LYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLAN 115
            :.|||        ||  |:.:.........:..:|:| :|...:|..|:...:..|.|   ..:.
Zfish   195 SSNSGNDTSNVAKGQKKLFITSGDHEALTGQCLFFLR-ITDKAITTTNISQEVNFGML---DCSE 255

  Fly   116 LSILCDEVFFPLLNNTVNQVGWTNVIANDMKTESQE----MRNGIAQMKGLVIN--RTIFPLPIC 174
            .|||.:..|  ||...:||.           .:|||    :::|  ||...|.|  |::......
Zfish   256 SSILHNLEF--LLTQVMNQA-----------LKSQEDWGAIKDG--QMNPDVQNFLRSVDKFTFT 305

  Fly   175 MDEVMQ------------AAPAIAMGDISVV-----------NPLMKHSLEFMVVKWLDSVEDLV 216
            :..||:            :||     |:|.:           |..:...||.::|.|...:|.: 
Zfish   306 LSSVMRNMEEKFKLHHIPSAP-----DLSHIQKPEDYSYAANNSELVEDLEAVLVYWAKQIEQV- 364

  Fly   217 NIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIV 281
             :...|:|..:.:...|.|..:.|:.|:....:|.:::.|..:|.|..:|...:|.....::.:.
Zfish   365 -LTESERIRRESDDIGPSAELAHWKRRMITFCSLMDEIKDPYVKKIIGILHAAKSKTMSKWKELD 428

  Fly   282 ELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLF 346
            ..:.....||:|..|.||.|.:..:..|.:........|..||.:|.::...|::::|..:||..
Zfish   429 ASITIVANEAKDNVKYLSTLDKFFELLEKSTPTSMLKHIPKLMNSIHMIHRVSQFYNTSEHMTSL 493

  Fly   347 FNLFHNSLID------CVNRTVEPDSIFQGDVDEAYKK----LDINMQHLEYYKLIYNECRNSLK 401
            |....|.::.      |...|    .:::.|..|..|:    :::|.:        |.:|...:|
Zfish   494 FVKVTNQMVTTSKAYLCQGVT----KVWELDRKELLKRMKECIELNQE--------YQQCFRQMK 546

  Fly   402 KFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKGRQITFALE 466
            : ||....:.:.....::.|||:.|.|..|||::.|:..|:.||..|:.:...|         :|
Zfish   547 E-KIQQNPHERQLELSENYIFGKFDTFCKRLEKITDMATTLEDFSVLQFMKFEG---------VE 601

  Fly   467 KILEEYNSIYREWTNIQYNPIDPDAENSL-FQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLL 530
            ||...|.:|.....:..||.:|   ...| |..|.:.|:.:..|:     :|....|.||     
Zfish   602 KIYMRYQNIVSTIKSKTYNVLD---HRKLEFDNDYIEFRNQIQVL-----YQSVDALIDT----- 653

  Fly   531 AGSLLLRPIIKKHVEPLMH-----------------VIVDDFEEEI----MCVKKEFINFKNVFT 574
               .|.||:..:.|..|:.                 |::..:|.::    .|.:||..|      
Zfish   654 ---WLQRPLTTEQVLELLSRFENGVGRQMDLNQKYMVVLQRYECDLEFVRKCYQKEKDN------ 709

  Fly   575 ALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIM----- 634
                   |.....| ::|.|.:.|.|..:|          |.|:      ..:.|..:|:     
Zfish   710 -------PVSQLTP-LAGKIEWSKHLFKKI----------ELPM------QILKDKLDILQMPDR 750

  Fly   635 ---VQEIDDFTKMLLDKWTV--ECW-QGIQQDIT----LTLIEKDEANELRVNFTERLIFALKDI 689
               ::..:....:||:...:  :.| :|::..::    ..|.......|..||....::..|::.
Zfish   751 RKIIRSYNRLAAVLLEYEMIHQKAWVEGVELGLSGLNASLLTRHPTTKEFYVNLDPLVLEVLQEA 815

  Fly   690 KVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMK 754
            ..:..||..|...:.....:|.:|.:.|.||..:.:.::...::.....|..:...:..:|..:.
Zfish   816 NNMYKLGALVPDGIHDMAAKEPQLKEYRYKLQMMLKEFHAVVKKIPGVLKSPMKPFIRSVETALS 880

  Fly   755 PLLDFIKWNAFS-QRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLL 818
            |.|..:.|.:.: ..||..::|          |.||                      |...|.:
Zfish   881 PGLTILSWTSLNIDYFIGCVYK----------ALQE----------------------LEQVLKV 913

  Fly   819 HTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISL 883
            .||    ||..|..:..::.....||               :||         |::.:.|.:  .
Zfish   914 VTD----ILDCRINHTLESMCSTTLL---------------TLP---------ENEPVTPEM--F 948

  Fly   884 SVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEI---ITPFHRYELLK--GLSQEERALFR--- 940
            ...|:.....:||.:....  ::.|....|..||:   :.|..|..|.|  .|..:.:.:.|   
Zfish   949 LTHTAATISTERETLKVAS--QQVERSMLEIAEELNRMLKPSERVNLKKCSCLHPDAKQMTRCLQ 1011

  Fly   941 ----EYEIYVDEIIAEN---LVDSVITSSTYLR---MEVDNRYENNT--------PIFEIFMELQ 987
                .:.|.:.::...|   ||.:..:|...|.   :...:.|.:::        |:|.:.:||.
Zfish  1012 CLPCAFYIMMGQLCQRNTEALVTATKSSLNALHRRLLAASSSYRSSSPSGATIQVPLFRVSVELA 1076

  Fly   988 EPNVVYFRNLDTSSKTGFAFFIETILD-DMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSEL 1051
            .||:|:..:.:         .|:.||: .:|.::|:.|.:           |...|..|| :.:|
Zfish  1077 IPNIVFRPSFE---------HIQGILNKGVNMVLSMAKDI-----------PLWNYFHLQ-QDQL 1120

  Fly  1052 DKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLT-----LDERDAEAD 1111
            ..::|           |.|.||...:....:.:.....:::|.|...::|:     :....|:|.
Zfish  1121 QAEQV-----------AAREHGDETVVSKPILLRSLDRHVTEHKDVNKSLSQLVPLVSSLKADAG 1174

  Fly  1112 --LEGSSGVKLLGLEYPPLSVYKEQLDKFIE----LQD---QIRTWETYEDFFVFLRLNMT---- 1163
              ||..|....|..:.|     .||:..|::    |.|   |:..:..||.....|....|    
Zfish  1175 DILEDLSQFSALWNQDP-----AEQVKAFLQTNPILADFSTQLSLYSAYETQIHELPQTCTVGPI 1234

  Fly  1164 -----GFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQK--DDFEGLVKI 1221
                 ..|::::.:...|...|...|..:....:.|:..|||..|    .:||:  .|.:.:.:.
Zfish  1235 LFETESLKMSLIQECHTWKREFGAALNQQASAGMTEISSFVDGVN----RQLQRPISDLDDVRES 1295

  Fly  1222 LSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIA 1286
            :..|.::.|::...:::..|::|...||.:::..|.|....:|:.:..||.::|.:|..|::.::
Zfish  1296 MGALRELREEEIRIETIMGPVEESFALLNRHDLFFNDGNAERIDGVVYAWKELKVMAKETQKKLS 1360

  Fly  1287 PIQSYQ-------VDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEER 1344
            .::.:.       |::.:|.:                        .|.|...|.|...:..|..|
Zfish  1361 DVEPHMKAELIAGVEVFQKSV------------------------ESFYGDYDNSGPGVTGLPPR 1401

  Fly  1345 QRS------------LAESAVLF----ELQG------PDPVKIELCRFDLKLVKIMWDFAITIQS 1387
            :.|            |....|.|    ||.|      ||..:|   :.:|.|:..::....::..
Zfish  1402 EASDRLQVYQAKFDELWRKYVTFSSGEELFGLPVGEYPDLHRI---KRELNLLSKLYSLYNSVID 1463

  Fly  1388 TINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNP 1452
            :::.:....|..::||.::.|...|...:|.|..|::.|:.|..::.::.:...:...:..:.|.
Zfish  1464 SVSGYYDILWADLNIEKINNELLDFQNRIRKLPAALKEWQAFNDLKKTIDDFNETCPLLYMMANK 1528

  Fly  1453 AIRDRHWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATA 1516
            |:..|||..:...||.||.:: .:.:|:::::..|.:.:|:::::...:|||..:|.:|:|:.|.
Zfish  1529 AMMARHWERITDLTKHKFEVEAPNFSLRNVMEAPLLKCKEDIEDVCISAVKERDIEAKLKDVVTE 1593

  Fly  1517 WGTMEFGTDIHDRTSIKLLKASE--ELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNAD 1579
            |...:|...........|||.|:  |.:..:||....|.::.|::|.|.|:..::.|..:|||:.
Zfish  1594 WSGHQFTFATFRNRGELLLKGSDTSEKVALMEDSLMVLGSLMSNRYNAPFKPTIQQWVQKLSNSS 1658

  Fly  1580 QIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRST--NR 1642
            ::|..|..||..|.|||::|:|. ||..|||::::||..|||.::.::.:.:....||:..  :.
Zfish  1659 EVIEKWLTVQNLWLYLEAVFVGG-DIAKQLPQEAKRFQNIDKSWQRIMQRAHEIPGVVQCCVGDE 1722

  Fly  1643 SGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKL 1707
            :..:|..|   ||:.|.:|:|:|:.|||.|||.:|||:|||...||:||...::...:..||..|
Zfish  1723 TLQQLLPH---LLEQLEVCQKSLSGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNL 1784

  Fly  1708 YDSMGKLNLISGSKNAAGMVAKELE--EYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSL 1770
            :|::.:  ::...||...:::.:.:  |.|...|..:..|.||.||..:.|.::.||...::::.
Zfish  1785 FDNVNR--VVFHEKNYDQILSFQSQEGETVNMSEPINAQGNVEAWLGMLLDGVKKTLHSIIRQAA 1847

  Fly  1771 TFYDHKPRHVWIFE--WPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLII 1833
            .....:...:..|:  :|||..|:|.|.:||.:..:|..: .:..:..::..|:|.:..||.||.
Zfish  1848 MVIGDQGFKLVEFQSMFPAQVGLLGIQFIWTRDAEEALQQ-SKADKKIMQTTNQKFLDLLNELID 1911

  Fly  1834 LLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICD 1898
            :...|||..||.|..|:.||.||.:|:...::...:.....|:||.|.|..:....|.|...|.|
Zfish  1912 MTTHDLTKMERTKYETLITIHVHQKDIFDDLVQMNIRSPLDFEWQKQSRFYFIDDTDRCIIQITD 1976

  Fly  1899 AQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVY 1963
            .:|.|..||||.|.|||||||||||||||.|:|.:.|||||||||||||||||||:||.||..|.
Zfish  1977 VEFDYCNEYLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVV 2041

  Fly  1964 VFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFL- 2027
            |||||:|||::.:|.|:|||||:||||||||||||.:.||||.|.|:..:....|:||..|.|. 
Zfish  2042 VFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTD 2106

  Fly  2028 GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLAR 2092
            |:.:.:....|:|:|||||||||.|||||||..:|..||:|||.|:|..:.|.:.||:|.::|:|
Zfish  2107 GDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSR 2171

  Fly  2093 KFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDD 2157
            ||.|||.||:|.||||.|||:|||.|.|||...||::|.:...||..|:||.|||.|:.|:|.:|
Zfish  2172 KFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDED 2236

  Fly  2158 VPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIG 2222
            .|:||.||.||||.:.:.:...|:.||.|.:.|.:..|.....:|||:|||.|...|||.:..:|
Zfish  2237 EPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLG 2301

  Fly  2223 FAGTGKSEVWKTLNKTYQNQKRKPHYN-DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQAN 2286
            .:||||:....||.|. ......||.. .:||||:|..::||.::.:|.:|.||:||.|.|....
Zfish  2302 PSGTGKTTCIHTLMKA-MTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLK 2365

  Fly  2287 LGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVS 2351
            .......||||||.:|.:|||:||:|:||||.||||:.:||.:....:::||..::..|:|||||
Zfish  2366 SKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVS 2430

  Fly  2352 RAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARL 2416
            |.|:::::...|.|.|.:|:|| .:....:..:|...|:.....|::...|.:.....:.:...:
Zfish  2431 RNGMVFMSSSVLDWQPILQAWL-KKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYI 2494

  Fly  2417 QMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKA-V 2480
            :.|..||..:| |.....:.........|:|.::|..|:.:   ::.|.:.  .:.||.::.| :
Zfish  2495 KQTIDLLQGLL-PAVEEKNLNAAHINRLFIFAVMWSAGALM---ELEDRAK--MEVFLKKHNARL 2553

  Fly  2481 KFPLS---GTIFSFYIDHETKKFFPWTNLVPQFELDMD-LP-LQSNLVNTAETTRLRFFMDTLIE 2540
            ..|.:   .|||.|.:. .|.::..|...||::....| :| ..|.||...:..|..|.|.|:::
Zfish  2554 DLPSTQGEQTIFEFLVS-STGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMK 2617

  Fly  2541 ADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGP 2605
            ....::|||..|:.||:::....|....:.....::.|:..|...|.|:.:|..::|:.|..|||
Zfish  2618 QGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGP 2682

  Fly  2606 IGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK----MTLRDIHKCNIVACMNP 2666
            .|.|:|..||||:|||.::::.....:.::||.|....:|..::    .|:.|:..  :.|.::|
Zfish  2683 PGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQL--VAAMIHP 2745

  Fly  2667 SAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQK-FDKAVIKLCENMVTTAIT 2730
            ..|...|..||:|.||.|....||..::..|.:::.|.:.  .::: |.:.|..|...:|.|...
Zfish  2746 GGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYF--CVERGFPEEVCSLAAALVPTTRK 2808

  Fly  2731 LHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDY 2795
            :...|.:..||:..||||.|||||::.|:.|:|...||.|.....:..|:.|||.||..|:.:|.
Zfish  2809 VWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDE 2873

  Fly  2796 TDINSFKKIVSDIVRKG---------------IEGVND--DVVYAQPLIYCHFAKGLTDIKYMPI 2843
            .|..:|..|:..|..:.               ::.:.|  ::...:|    ..|:..|...|.||
Zfish  2874 KDRETFDGILERITAQDHGPSLLEQGPWQGYFVDFLRDAPEMTGEEP----EDAEEETPKVYEPI 2934

  Fly  2844 SGWDRLKSLLDEAQDRYNDYI--GAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSL 2906
            ..:..|...|...|::||:.:  .||:||.|:|||.|:.:||||:.::||.|||:||||||||||
Zfish  2935 PTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSL 2999

  Fly  2907 TRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDL 2971
            |||||||:....|||.||:.|:||:|..::..||..||::.....|:.||:::..|.||..:|::
Zfish  3000 TRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNV 3064

  Fly  2972 LASGDIHELFPDDEVENI----VNAVRNEVKQL-GIVDNRENCWKYFIEKVRSLLKVVLCFSPVG 3031
            ||||::..||..|||:.|    :.|::.::.:. ..:||..|   ||:.:|||.|.|.|||||||
Zfish  3065 LASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYN---YFLSRVRSNLHVALCFSPVG 3126

  Fly  3032 ATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITV-LPKELALPVSNFMAFVHKTVN 3095
            ..||.|:.|||.|::..|:|||..||:.||.:|:..|||..:: ...|:...|...|......|.
Zfish  3127 EKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVA 3191

  Fly  3096 DISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQD 3160
            :|...|....:|..|.||||:|..|..|..:..||::.......|:..||.:|......|:.|:.
Zfish  3192 EICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRV 3256

  Fly  3161 VLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKA 3225
            .|:.:|..|::..|:|..:::.|..:.:...|.:|...|.:...:.|.:::....|:.|.....|
Zfish  3257 ELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAA 3321

  Fly  3226 QPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK-GKIPKD-------RSWKA 3282
            :|||.|::.||.|:...::..::..|.||..::.:...||:||..: ..:..|       .||..
Zfish  3322 KPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGE 3386

  Fly  3283 CRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRF 3347
            ....|.| ..||..|:|::|..|..:|::.|.||:...:::.|.........||||||...:..|
Zfish  3387 ALKLMNN-SGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEF 3450

  Fly  3348 YDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQME-------YDEALAKKQK 3405
            :.:...|.|     |::..::::||  ||.....|:..:|||:|.|.|       ||.|:.:||.
Zfish  3451 FGINKEVLP-----LKANLKLQEAR--LTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQD 3508

  Fly  3406 CQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYR 3470
            ..|:|......:..|..||.||..|||||.||.......|:.:.||:|:.:.|:||.|.|.:.||
Zfish  3509 LLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYR 3573

  Fly  3471 QELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYP 3535
            ..|.:: |.....:..  ||.::.::...|:.|:|.|.|||.||||:|.:|.:|..|:.::.|||
Zfish  3574 TLLMQQ-WKKEMDSRH--IPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYP 3635

  Fly  3536 LMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGR 3599
            |:||||.||..|:|.: ....|.|..|:.:.:...:|..:|.|..||:|::||.:||||:.:|.:
Zfish  3636 LLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEK 3700

  Fly  3600 QLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEV 3662
            ..||.|  :.:|:||:|:|....|.|.:.||||||.|.||:.|:|.:::||||..|||||||..|
Zfish  3701 NFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRV 3765

  Fly  3663 VKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIE 3727
            :.:|:.::||.|.:|.::....|..::.||.:||.||:|...:::||.:|:..|:.||.||.|:.
Zfish  3766 ILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVS 3830

  Fly  3728 VKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAA 3792
            .|:..|..|.:.|:.|||.|||.|.|.||:||::.::..:|.:||.||:.|..:|:.:|.|:..:
Zfish  3831 QKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKS 3895

  Fly  3793 EKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR------ 3851
            :....|:||:::.:||..|.||:|||:|..|.:|...|.::|.:....:...||...::      
Zfish  3896 QVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLD 3960

  Fly  3852 ---FPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGE 3913
               ....|.:     |:....|..:..|::...|..|...:..:.:.||.:.|..:||....|..
Zfish  3961 LNSVEAKPKR-----WILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDG 4020

  Fly  3914 WKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSP 3977
            ::.: .|.::|.::|...|||.....|.:|.|.:|.||.:...::......|:.....:...||.
Zfish  4021 YESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSM 4085

  Fly  3978 GVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPS 4042
            |.||.:::::|.||.|..     ...:|:|||||:.|...:..:...|.|::|||.||   .|..
Zfish  4086 GSDPTENIDRLAKSKGIP-----CRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHL---GLDF 4142

  Fly  4043 LEKKME--SSLSNVHTSYRLFLSAEPAGDPAAH-ILPQGILESAIKITNEPPTGMMANIHKALDN 4104
            |::.:|  ::..|:|.::||:::.:      .| ..|...|:|:||.|||||.|:.|.:.:..::
Zfish  4143 LDEGLETVTTTENIHDNFRLWVTTD------VHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNS 4201

  Fly  4105 FSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL--- 4166
            .:.|.||: :...:::.:.:::.:.|..|.|||||||.|||..|.||..|.|.||..:.|:|   
Zfish  4202 VTQEQLEI-TNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDI 4265

  Fly  4167 EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYT 4231
            :....|.|..|||:.||:.|||.:|||.|:||..|:...:....:...:..:.:|:..|......
Zfish  4266 DIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQ 4330

  Fly  4232 GYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKN 4296
            .||.:||.....::|.::|||.||:|.:.|.::......:..:||:   .||.||..::|..::.
Zfish  4331 DYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPK---DSSSGEGETRESSVQK 4392

  Fly  4297 IIEDILDKTPTPF------NILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKG 4355
            :..::|:|.|..:      :.|:.||..:   |..|...||.:||..::..::.:|.:|.|.:.|
Zfish  4393 MANEMLEKLPADYVPHEVKSSLQKMGAFQ---PMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDG 4454

  Fly  4356 ELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLA 4420
            .:.:|..:.|.:..:|..:||:.|.|:::.: ..|..||::|:.|.::...|..:.| |...||.
Zfish  4455 TIIMSEDLRDALDSMYDARVPKSWQKISWEA-ASLGFWFTELLERNQQFYSWTFNGR-PLQFWLT 4517

  Fly  4421 GFFNPQSLLTAIMQQTARKN---EWPLDRMCLNCDVTKKWKEELTTAPRE---GAYINGLFMEGA 4479
            ||||||..|||:.|:|.|.|   .|.||.:.|..|||:..||::|:.|..   |.||.||:::||
Zfish  4518 GFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGA 4582

  Fly  4480 RWDMKMGTIADAFLKELFPAMPVLYIKAV---TQDKQDIKNVYECPVY-KIRLRGPTFVWTFNLK 4540
            .||.:...:.::..|.||..:||:::.||   |:.|:...|:|.|||| |.|....|::::..|:
Zfish  4583 GWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTESKKPAMNLYSCPVYKKPRRTDLTYIFSLFLR 4647

  Fly  4541 SRERASKWTLAGVCLL 4556
            |.:....|||.||.||
Zfish  4648 SSQNPDHWTLRGVALL 4663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 121/613 (20%)
DHC_N2 1368..1770 CDD:285579 112/409 (27%)
P-loop_NTPase 1903..2132 CDD:304359 143/230 (62%)
P-loop_NTPase 2217..2352 CDD:304359 56/136 (41%)
P-loop_NTPase 2510..2783 CDD:304359 81/280 (29%)
P-loop_NTPase 2860..3127 CDD:304359 119/275 (43%)
MT 3140..3480 CDD:289543 102/355 (29%)
AAA_9 3509..3722 CDD:289547 91/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 216/708 (31%)
dnah5lXP_002666734.3 DHC_N1 345..896 CDD:285571 121/621 (19%)
DHC_N2 1444..1846 CDD:285579 113/411 (27%)
P-loop_NTPase 1981..2212 CDD:304359 143/231 (62%)
P-loop_NTPase 2296..2431 CDD:304359 56/136 (41%)
P-loop_NTPase 2597..2861 CDD:304359 79/268 (29%)
P-loop_NTPase 2951..3220 CDD:304359 119/272 (44%)
MT 3235..3580 CDD:289543 101/354 (29%)
AAA_9 3609..3825 CDD:289547 91/216 (42%)
Dynein_heavy 3971..4656 CDD:281078 216/708 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.