DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah6

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001158141.1 Gene:Dnah6 MGIID:107744 Length:4144 Species:Mus musculus

Alignment Length:4194 Identity:1303/4195 (31%)
Similarity:2137/4195 (51%) Gaps:491/4195 (12%)


  Fly   610 EHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVE---CWQGIQQDITLTLIEKDEA 671
            ||..:.|.:....:.....|.:|:.|...::..|.  |.:|:.   .......||....||:.|.
Mouse   194 EHLGFLYMISAVPKSSIEYDTYNLKVVSYENINKN--DYYTISKDAVTHVYNDDIEYIEIERWEQ 256

  Fly   672 NEL-RVNFTERLIFAL-----------KDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIA 724
            ..| ....|:..||||           |:::..::.||..::....|....    ..|..|::|.
Mouse   257 EYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNP----YLRPALLKIN 317

  Fly   725 EW-YNDTF------ERAHP-TEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLH 781
            |. |..:|      |:.|. |.:...||:::.::|..:.|..|                      
Mouse   318 EMCYLLSFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVF---------------------- 360

  Fly   782 DRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMY 846
             |..|.....::.:.::|:.|.:|    .|      ...:..|.......|:..|..        
Mouse   361 -RCAAKDVVRKSCRFALRAAGFIP----DD------CEVETYEDYFKANIASLVDGP-------- 406

  Fly   847 VNLKLFFDIPRRYSLPPGEHGEED-----EESDG-----------------IWPPIISLSVMT-- 887
                  ||:|        .:||.:     |::..                 |...:..|:|.|  
Mouse   407 ------FDLP--------TYGESEKMTYTEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTAS 457

  Fly   888 ------SVKFKK--KREVIDE---EDDLEEFEEE-----QSESEEEIITPFHRYELLKGLSQEER 936
                  |.|.|:  ..:||.:   |:..|..|::     :.:.|:|.:.|....||:..:   :.
Mouse   458 SLLNFFSDKLKRTPSADVIQKWITEEKPEVTEKKGAPLMEKQEEDESLVPMFLTELILTV---QS 519

  Fly   937 ALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVV---YFR--- 995
            .||        |...|:.:|.:..:.        |.:||..        |..||:|   ||.   
Mouse   520 LLF--------EPSLEDFLDGISGAI--------NHFENTV--------LSVPNLVPDSYFDAFT 560

  Fly   996 ----NLDTSSKT-GFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQR 1055
                |.....|| |....:..:.:|..|.::::                                
Mouse   561 SPFINKKVEEKTCGPGPNLSAVFEDDRNFLTII-------------------------------- 593

  Fly  1056 VEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKL 1120
            ::|...|..|..:.|::...|.:|...              |..|.:||             ::.
Mouse   594 MQIKETIHAAFDSARLYAATFEKFQLF--------------FKENESLD-------------LEA 631

  Fly  1121 LGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWI---SLFKL 1182
            |..|.|.:..:..||:|:         .:.::|..........|..:....|:.:.:   .|..|
Mouse   632 LKQEEPDVQFFSSQLEKY---------HKQHKDSVALRPTRNVGLLLIDTKQLKEKLIPSPLRCL 687

  Fly  1183 DLINRVKNSL--KELQDFVDEA-NIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKE 1244
            :::|.:...|  |::...:.|| :...|:|.........|..|..|::|.|:....:...:.:.:
Mouse   688 EVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQ 752

  Fly  1245 IIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANT 1309
            :..|:.||          |:...|:.:    .:.||.|..|..::    :.|:|.:    ....|
Mouse   753 MYKLIEQY----------QVPTPPEDF----AVFATMKPSITAVR----NAIDKSV----GDRET 795

  Fly  1310 YRKKF----------LSKKFFFVPCLSCYELIDESDLELVALEERQRSLAE--SAVLFELQG--- 1359
            ..|:|          |:.:...|..|:    .|...|::.|.:|:.:::..  .:||.:||.   
Mouse   796 SIKQFCLHLGRDLEDLNNEVNEVKLLA----QDPQILDISADQEKIKTMLSDLQSVLDDLQKRAF 856

  Fly  1360 -----PDPVKIELCRFD--------LKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKK 1411
                 ....|:|:.:||        |:|.:::||......:...:|.|:.:..:|.|.::.:..|
Mouse   857 QYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTK 921

  Fly  1412 FGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTT-KVKFSMDDS 1475
            :.:.:..|:|.:........::..::.:...|..:.:|:||.::.|||..:.||. .:....:..
Mouse   922 YAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIP 986

  Fly  1476 TTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIH-DRTSIKLLKASE 1539
            .||:.|.:|::..:.:|:::|..::..|.|:|..|:.:..:|.|.||....| |...:.:|..::
Mouse   987 LTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTD 1051

  Fly  1540 ELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSED 1604
            ::...|:|....:..:|||:|:...:..|..||.:||..:|.:..|...||.|.|||||| .:.|
Mouse  1052 DIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIF-NAPD 1115

  Fly  1605 IRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG-SKLYEHLEILLKMLLLCEKALNDY 1668
            |:.|||.:::.|..:||.:|.::.::|...|.:|:..:.| .:.:::...||..:   :|.|..|
Mouse  1116 IQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQI---QKCLEAY 1177

  Fly  1669 LETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL---------ISG----- 1719
            ||:||:.:|||||:|:.:||:||:...||..|..||.|.:||:.||..         |.|     
Mouse  1178 LESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEP 1242

  Fly  1720 ----SKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHV 1780
                :.:...|::.| .|.|...:.....|.||.||.::.:.|..:||...|.::..|..|||..
Mouse  1243 EKVFTNDILAMLSPE-GERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTE 1306

  Fly  1781 WIFE-WPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAER 1844
            |:.. .|:|..|..:||||..:..::. :.:....:||:|:.:....:||.|..::.|:|....|
Mouse  1307 WVIAGHPSQVILTISQIMWCRDLTESL-ECEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHR 1370

  Fly  1845 QKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLG 1909
            ..|..:.|||||:||:|..::..||:...:|.||.|||:.||..:|:|.|.:..:|:.|.|||||
Mouse  1371 NIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLG 1435

  Fly  1910 NTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYK 1974
            ..|||||||||||||:.|..:|.|.:|||||||||||||||||||.:||.:...|||||:.:|||
Mouse  1436 ACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYK 1500

  Fly  1975 SIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGV 2039
            .:|....||||:|||.||||||||.:|||||:|.|:..|::|..:|...|.|.|..|.|..|...
Mouse  1501 MMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAA 1565

  Fly  2040 FITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKEL 2104
            |||||||||||.|||:|||||:||.||:||::|||:|::|.:|||:.:::||||...:|.||.|.
Mouse  1566 FITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQ 1630

  Fly  2105 LSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLF 2169
            ||:|||||:|:||:|||||:||:|:|::....||.||:|||||.|:||.:|||..:|.|:|.|||
Mouse  1631 LSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSGIISDLF 1695

  Fly  2170 PALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKT 2234
            |.:.:|.......::.|....::..||||...:.|::||.|...|||.|.::|..|.||:.|::.
Mouse  1696 PGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQV 1760

  Fly  2235 LNKTYQNQKR----KPHYND-----LNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGT 2290
            |.:|..|.::    .|.|..     ||||::|..||:|.||..|.||||||.::.:|...|....
Mouse  1761 LAETLGNLEKLNTDNPFYQPVKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSE 1825

  Fly  2291 GPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGI 2355
            ..|||:.||.:|.:|||::|||:||||:|.||::|||.||.::.:|||:..||.|:||||||.|:
Mouse  1826 DHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGM 1890

  Fly  2356 LYINPQDLGWTPFIQSWLGTRTN--SSEVS--MLNVLFDKYVPPLLDIFRTRLRSITPISDIARL 2416
            ::::|::|.|.|::::|:.|.:.  :.||.  :|| ||::||...|.....:.....|..||:::
Mouse  1891 VFVDPEELKWMPYVKTWMRTMSKKLNDEVQEYLLN-LFNRYVDDGLHFVNKKCTQAIPQVDISKV 1954

  Fly  2417 QMTCYLLDSMLTPQNVPNDCPKDWYEI------YFVFCIVWGFGSSLFQDQIIDWS--NEFSKWF 2473
            ...|.||:|:|..:: .|....:..::      .||||.:|..|.:|.::.   |.  :.|.:..
Mouse  1955 TTLCCLLESLLLSKD-GNILSMEQMKLNTVLCQTFVFCYLWSLGGNLTENY---WDSFDTFIRTQ 2015

  Fly  2474 LNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTL 2538
            .::....:.|.||.::|.:||.:||:..||..::|.|:...|:|....||.|.:|.|..:.|:.|
Mouse  2016 FDDNPDARLPSSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKL 2080

  Fly  2539 IEADHPLMLIGPSGSGKTILMNAKLSAL-PSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRN 2602
            :...|.::..|.:|.||:::....|:.: .|..|....:.|:..|:|...|.|:|..||:|....
Mouse  2081 LAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNI 2145

  Fly  2603 YGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIV-ACMNP 2666
            .|..|||:::.||||:|||.:|:|.:..|..|:||:.|:..:|||.|:..::|....|| ||..|
Mouse  2146 LGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPP 2210

  Fly  2667 SAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITL 2731
            ..|...:.||..|||....:..||:.:|..|..:||:..:.:    |.:||.:...|:|..|:.:
Mouse  2211 GGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLAD----FPEAVKQTSSNIVEAAVEI 2271

  Fly  2732 HLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYT 2796
            :.::....|||..|.||.|||||::....|:|..:..|.....|:.||:.|||.||:.|:|::..
Mouse  2272 YNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNE 2336

  Fly  2797 DINSFKKIVSDIVRKGIEGVNDDVVY--AQPLIYCHFAK---GLTDIKYMPISGWDRLKSLLDEA 2856
            |.:.|..|::::..|.. |:..|:.|  ::|:|:..|.|   ..:|..|..:...::::::|.:.
Mouse  2337 DKHYFHLILTEMANKHF-GIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDY 2400

  Fly  2857 QDRYN-DYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQ 2920
            .|.|| .....:.||.|.||:.||.||:|::...||.|||:||||:|||||||||:.|......|
Mouse  2401 LDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQ 2465

  Fly  2921 IQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDE 2985
            |:|::.|:..:...::..||..|||:.....||.||:::..|:||..:|::|.||::..||..||
Mouse  2466 IELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDE 2530

  Fly  2986 VENIVNAVRNEVKQLGIVD-NRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTT 3049
            :|:::.|.|.:.|::||.: ||:..::|||.:||..|.:|||.||||...|.|.|.||:||||.|
Mouse  2531 LEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCT 2595

  Fly  3050 IDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPK 3114
            ||||.:||::||.|||..|.|.:.....:|...:|.....||.:|:.:::.|....:|..||||.
Mouse  2596 IDWFVQWPREALLSVSKSFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPT 2660

  Fly  3115 SFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNL 3179
            |:||||.||..:|.||.|..:..|.|::|||.||......||.::..|...|..|..|:|:.:.|
Mouse  2661 SYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVEAL 2725

  Fly  3180 IIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNL 3244
            :..:..:.|...:.|....::|...:...|:..|.|...:.|..:|.|||.||.:||::|:|.::
Mouse  2726 MEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADI 2790

  Fly  3245 TELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDV 3309
            :|::.|..|||.|::|..|:.:|.::|      ..|...:..:|: ..||..|:.|||::|.|.:
Mouse  2791 SEIRVFTKPPDLVMTVMEAISILLNAK------PDWPTAKQLLGD-SNFLRRLLEYDKENIKPQI 2848

  Fly  3310 IKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDK 3374
            :..||.||.:.:|.|||:...|.|...:|.||..::.:..|...||||.:.|..::.|:......
Mouse  2849 LLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMAT 2913

  Fly  3375 LTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVK 3439
            |......|.::|:|:..||.:|::.:.:|:......:.|...:..|.:|...|..|::||.||::
Mouse  2914 LKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIE 2978

  Fly  3440 VLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPI-PSTDGV----DPFE 3499
            .....:..:.|::.|.:..::|.|.||..|||.|.| .|:.:....:.|| ||...:    ||:|
Mouse  2979 KFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIE-WWIESCLALEIPIDPSFSLINILGDPYE 3042

  Fly  3500 MICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYG-TGLVVLRLSQ 3563
                   |.:||..|||.|.:|.||..::.|..|:|||||||.|..:|::.|.. :||.|::|:.
Mouse  3043 -------IRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTD 3100

  Fly  3564 RNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILH 3626
            .|:|..:|.::..|..:|:|.:.|.:||.|.|:|.:|....|  .::.:||.:||::..||..:.
Mouse  3101 TNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMT 3165

  Fly  3627 TKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFL 3691
            :|:.||||.||:..:.|:||||||:.|||||||::||::|:|:||..|.:|..:.|..|..||.:
Mouse  3166 SKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSI 3230

  Fly  3692 EDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASI 3756
            ||.:|..|.::..|:|::..|:..|:.:|.|:..|:.::.||:.|.:.|:.|||.|||.|.:.|:
Mouse  3231 EDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSV 3295

  Fly  3757 IYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQ 3821
            :||::..|.:|:|:||:|||.|..:||..:..:..::.|.:|::.|:......::...|||||||
Mouse  3296 MYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQ 3360

  Fly  3822 DKLIFLTQLCIQILVNLGEVEPTELDFLLR--------FPYMPNQTSNFTWLTHVGWGGIRALNN 3878
            .|||:...||:.|:....::...|.:|.||        .|..|..    .||....|.....|..
Mouse  3361 HKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEA----PWLPIQMWFSCCDLEE 3421

  Fly  3879 Q-AVFKGLEKDI--------EGSHKRWKKFVDSESPENEKFPGEWKGK----------------- 3917
            . .:|:||.|.|        .||   ::.:::         |..|:|.                 
Mouse  3422 SFPIFEGLTKHILLRPISIKLGS---FETYIN---------PPVWEGYPKQRHEEEKDHVWGLDF 3474

  Fly  3918 SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPL 3982
            |:..:|.:::|.:.:::.:|:..|:.|.||.::|:...::.:..:::.|..|.:.|:||.|.||:
Mouse  3475 SSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPM 3539

  Fly  3983 KDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLE--- 4044
            ...::..:..|::   |...|:||||||..:||..|:.|.:.|:||.|||.||...|:.::|   
Mouse  3540 GAFQRFARESGYA---ERVQSISLGQGQGPIAEKMIKDAMKTGNWVFLQNCHLAVSWMLAMEELI 3601

  Fly  4045 KKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDET 4109
            |........:..::|||||:.|..     ..|..:|::::|:|||||.|:.|||.:|....:...
Mouse  3602 KTFTDPNQTIKDTFRLFLSSMPCS-----TFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSF 3661

  Fly  4110 LEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPW 4174
            .|......:::.::|.:|:|||::.||:||||.|||..|.||..|...::..|..|.... ::||
Mouse  3662 FEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEG-KIPW 3725

  Fly  4175 EDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG--FPAPGILKYTGYHNYI 4237
            :.|.|:.|||.|||.:||.||:|..||.|:.|..||.:|.:..|...  :.||.......:..||
Mouse  3726 DALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDDDYTYSDSGIYFAPLADSLQDFKEYI 3790

  Fly  4238 DDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDIL 4302
            :|....:.|.::|:|.||.:.|....:..|...:.|:|||   .||||:..|.::|::.::..|.
Mouse  3791 EDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPR---SSSGGQGKSNDEIVQELVASIQ 3852

  Fly  4303 DKTPTPFNILELMGRVED---RSP------YIIVAFQECERMNNLMTELKRSLNELDLGLKGELT 4358
            .:.|   ..|::.|..|.   :.|      ...|..||.:|.|||:..:..||..|:..:.|.:.
Mouse  3853 TRVP---ESLQMEGASESLFVKDPQGRLNSLTTVLGQEVDRFNNLLKLIHISLETLNKAIAGLVV 3914

  Fly  4359 ISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFF 4423
            :|..||.:......:|||..|:..||||:..|.||..||:||...::.|:.. ..|.|.|::|||
Mouse  3915 MSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGSWVKDLILRTEFVDLWLKR-GQPKSFWISGFF 3978

  Fly  4424 NPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTT--------------------APREG 4468
            .||..||..:|..|||...|:|.:....::...::::...                    :|.:|
Mouse  3979 FPQGFLTGTLQNHARKYNLPIDELSFKYNMIPVYRDQAAVIESAKDIQFGTELPMDKELPSPEDG 4043

  Fly  4469 AYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPT- 4532
            ..::|:||:.:|||.|...|.||...::.|.:||::.:. .|:.:.:..:|..|:||...|..| 
Mouse  4044 VLVHGMFMDASRWDDKDMVIEDALPGQMNPMLPVVHFEP-KQNYEPVHTLYHSPLYKTGARAGTL 4107

  Fly  4533 --------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
                    ||.|..|.|:..:..|...|..||.|
Mouse  4108 STTGHSTNFVVTVLLPSKRISDYWISKGSALLCQ 4141

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 38/176 (22%)
DHC_N2 1368..1770 CDD:285579 118/431 (27%)
P-loop_NTPase 1903..2132 CDD:304359 143/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 65/144 (45%)
P-loop_NTPase 2510..2783 CDD:304359 91/275 (33%)
P-loop_NTPase 2860..3127 CDD:304359 117/269 (43%)
MT 3140..3480 CDD:289543 100/340 (29%)
AAA_9 3509..3722 CDD:289547 87/216 (40%)
Dynein_heavy 3864..4549 CDD:281078 220/754 (29%)
Dnah6NP_001158141.1 DHC_N2 878..1296 CDD:285579 116/423 (27%)
P-loop_NTPase 1429..1659 CDD:304359 143/230 (62%)
P-loop_NTPase 1743..1888 CDD:304359 66/145 (46%)
P-loop_NTPase 2052..2323 CDD:304359 91/275 (33%)
P-loop_NTPase 2404..2673 CDD:304359 117/269 (43%)
MT 2685..3017 CDD:289543 100/340 (29%)
AAA_9 3045..3261 CDD:289547 87/216 (40%)
Dynein_heavy 3402..4132 CDD:281078 221/763 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.