DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah2

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_011247376.1 Gene:Dnah2 MGIID:107731 Length:4544 Species:Mus musculus

Alignment Length:4712 Identity:1479/4713 (31%)
Similarity:2426/4713 (51%) Gaps:461/4713 (10%)


  Fly    21 YLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPVRPRYKVAYF 85
            :|::||...|...|   .|.|...|:..|:.:|....:...|:....|......||:.:.::.||
Mouse   115 FLSRTMLTGLADAT---WTGEHDMVLEHFVQDPAVPALTIFIDPVFGLKLELGMPVQTQNQIVYF 176

  Fly    86 IRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFP--LLNNTVNQVGWTNVIANDMKTE 148
            ||. .|:.:|.||...::..|.:....:..|..|...|:.|  .:|.:     |...|.|...:.
Mouse   177 IRQ-APVPITPENFEETVQYGTVRGAYIPALLRLLSGVYVPQIFMNKS-----WPESIRNHFVSH 235

  Fly   149 SQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVE 213
            .......:...:..:...|:..:|.   |.:|..|.:.:.|..:|     ..||..::.|...::
Mouse   236 LHRFLASLTDTRYKLEGHTVLYIPA---EAVQMDPEVVVKDKELV-----QRLETSMIHWTRQIK 292

  Fly   214 DLVNIKAGEKIYSKENF-PLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSY 277
            ::  :.|.|.:.:.||. ||.|  ..||.:|..:|.::::||..:.:|.|..:|...:|.:...:
Mouse   293 EV--LSAQESVETGENLGPLEE--IEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPF 353

  Fly   278 RRIVELVLESLAEARDITKCLSPLK---RKMDKFETNDMDENRSDIRPLMLTIGLVWGHSRYFHT 339
            |::.:.:.:...:|:.....||.|:   :::...:..|:.|.   :..|:..|.::|.:|.:::|
Mouse   354 RKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEK---LPKLISLIRIIWVNSPHYNT 415

  Fly   340 LNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNSLKKFK 404
            ...:|..|....|.:|.....::..|.||:|.|:.:.:.|:..:...:.:|..|      |:..:
Mouse   416 RERLTALFRKMSNEIIRLCCHSISLDRIFEGYVNSSKEDLEGCISCCQAWKEHY------LRAVQ 474

  Fly   405 IGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMG------GLKGRQITF 463
            :.|.|:::.|...|..||.::|.|:.|.::|.::......|.:.|....|      |.:|.|||.
Mouse   475 MHTQFSNRGWVLDQTSIFAQVDAFVQRCKDLIEVCECQYHFARWEDGKQGPLPCFFGAQGPQITR 539

  Fly   464 ALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMV------SFQFEKGL 522
            .|.:|.:.::...:....::...:  |.:|:.:..|...|:.....:|.|.      :|:..:.:
Mouse   540 NLLEIEDIFHKNLQTLRAVRGGIL--DVKNTSWHEDYNKFRGGIKDLEVMTQNLITSAFELVRDV 602

  Fly   523 E------DTHDLLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLNEL 581
            |      ||...|.....::|...||.|:..|.     |..|:..|.:| :|.|..:        
Mouse   603 EHGVLLLDTFHRLATREAIMRTYEKKAVDLYML-----FNSELALVNRE-LNKKWPY-------- 653

  Fly   582 PTDDCFPKVSGAISFLKKLRHRI-------IGLH-------KEHELYEYPLFDNERGGYVSDIFN 632
             .:....:.||...:::.||.||       .|.|       .|..::.|               .
Mouse   654 -LEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAHFLPHIGTGEESIHTY---------------Q 702

  Fly   633 IMVQEIDDFTKMLLDKWTV----ECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIKVVR 693
            .|.|.||:..:....:||.    :|.:.:  |::|..|.:::...|.|||.:.|:....:|....
Mouse   703 QMAQAIDEMVRKTFQEWTATLDKDCIRRL--DMSLLRISQEKVGMLDVNFDKTLLILFAEIDYWE 765

  Fly   694 LLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLD 758
            .|..:....:.....|.::|...|..|:.:|..||.......|.|:.|....:..:::::.|.|.
Mouse   766 RLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLK 830

  Fly   759 FIKW-----NAFSQRFIVMIFKMVKYLHDRLVAA--QENLEAIKESIRSWGKVPLFQRKDLNPAL 816
            .:.|     :||   ||.         ..|:.|:  |..:...|.|..:.|    ::.::::..|
Mouse   831 KLNWALKGASAF---FIT---------ECRMHASKVQMIVNDFKASTLTIG----WKAQEMSELL 879

  Fly   817 LLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPII 881
            |:|...::                    :|.:|                                
Mouse   880 LVHITGKQ--------------------VYRDL-------------------------------- 892

  Fly   882 SLSVMTSVKFKKKREVIDEEDDLEEFEEEQSE---SEEEIITPFHR---------YELLKGLSQE 934
                                    ||||.|.|   :.::.:...|:         ||:.|....|
Mouse   893 ------------------------EFEEAQREHRMAAQQKLVKLHQDVVNIMTNSYEVFKNDGPE 933

  Fly   935 ERALFREYEIYVDEIIAENLVDSVITSSTYLRMEV--DNRYENNTPIFEIFMELQEPNVVYFRNL 997
            .:..:..|.|.:|.::.:.|..:|..|...|...:  |.:...| |:|.:.:.||.         
Mouse   934 IQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKTTPN-PLFRVLVILQN--------- 988

  Fly   998 DT---SSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDK------ 1053
            |.   .|:..|:..::|:...:|::.|.|         ...::.:....::..|.::::      
Mouse   989 DVRGGGSQVEFSPTLQTLASVVNDIGSHL---------FATISVFRHLPDILTKRKMNREPIYVL 1044

  Fly  1054 -QRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSG 1117
             :|.|.:.||:..:.:...:....:: :.|..||....:.|:.|                  .|.
Mouse  1045 VERDEDIRKIQAQISSGMTNNASLLQ-NYLKTWDMYREIWEINK------------------DSF 1090

  Fly  1118 VKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKL 1182
            ::......||:|.:...:.::.|:.:.::..||..: ..|:.|:.:..|.:::....:|.:.|..
Mouse  1091 IRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLN-IQFVMLDCSHLKFSLVQHCNEWQNKFTT 1154

  Fly  1183 DLINRVKNSLKELQDFV-DEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEII 1246
            .|.......|.:|..:: |.|.   ||.......|.|...|.:::.:.......::...|:.|..
Mouse  1155 LLKEMAAGRLADLHSYLKDNAE---KISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQF 1216

  Fly  1247 DLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAP-IQSYQVDLIEKRILLCDNMANTY 1310
            .:|.:|.....||.|..:..|...|:..:::...::|::.. .:.::..||        :.|:.:
Mouse  1217 TILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLI--------HAADDF 1273

  Fly  1311 RKKF--LSKKFFF-------VPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIE 1366
            :||.  |.:.|.|       |...:..:.|.:....|:|:.:.:.:|..:..:|:::.|....::
Mouse  1274 KKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQ 1338

  Fly  1367 LCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAM--RTWEPF 1429
            :...:|..::.:|:.....:.:.|.||...::.:..|.|:.......|.|..|.|..  |.||..
Mouse  1339 ILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEII 1403

  Fly  1430 IFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEYEEEV 1493
            ....:.::....::..:::|:|||:|:|||.::.:..:.:|..: :|.||:.::.|.:.::.|::
Mouse  1404 ETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKI 1468

  Fly  1494 KNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDI-------HDRTSIKLLKASEELIETLEDHQGQ 1551
            ..|...:.||:|:|..|::||..|.:.:.  ||       |.|     |:.:||:.:.|||:|..
Mouse  1469 AEISASATKELAIEVGLQNIAKTWDSTQL--DIVPYKDKGHHR-----LRGTEEVFQALEDNQVA 1526

  Fly  1552 LQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRF 1616
            |..|.:|:::..||.:|..|:..||...::|.....|||:|.|||:||:| ||||.|||.:|..|
Mouse  1527 LSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLG-EDIRKQLPNESALF 1590

  Fly  1617 DYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCE---KALNDYLETKRLSYPR 1678
            |.::..:||::.:||.|.|.:|||:..|.     ||.|::|..:.|   |:|:.||||||..:||
Mouse  1591 DQVNNNWKAIMDRMNKDNNALRSTHYPGL-----LETLIEMNAILEDIQKSLDMYLETKRHIFPR 1650

  Fly  1679 FYFVSSADLLDILSNGNNPALVARHLTKLYDSMG--KLNLISGSKN---AAGMVAKELEEYVPFL 1738
            |||:|:.|||:||....||..|..||.|.:|::.  |:..:.||.:   |.||.:.: .||:.||
Mouse  1651 FYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGD-GEYIDFL 1714

  Fly  1739 ENCDCSGKVEVWLNRITDKMRDTLRDQLKR---SLTFYDHKPRHVWIFEWPAQPALVGTQIMWTT 1800
            ......|.||.||..:...||.||||.|:.   :|..:.:| |..|:.:|..|..:..:||.||.
Mouse  1715 HPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNK-RDKWVKDWAGQVVITASQIQWTA 1778

  Fly  1801 ETNDAFAKVQQRYE-NALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTI 1864
            :........::|.: ..||...|||::.||.....:.|:||...|.||:.:.||::|:|||:..:
Mouse  1779 DVTKCLMTAKERSDKKILKVMKKKQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKL 1843

  Fly  1865 IAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQ 1929
            ....:...::|.|.||||..|:..:|||.....:.||:|.||||||:.||||||||||||:|||.
Mouse  1844 YKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTT 1908

  Fly  1930 SLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDE 1994
            :|||..||:|.||||||||||.||||:|||:.|.|.||||.:||||:|.::.||||:||||||||
Mouse  1909 ALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDE 1973

  Fly  1995 FNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKA 2059
            ||||::|||||||.|:..|..|:.:....|.|.|..|.|..:.|:|||||||||||.|||||||:
Mouse  1974 FNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKS 2038

  Fly  2060 LYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVV 2124
            ::||.||||||..||:||:|..|||...::||:|..|||:|..:.||:|||||:||||:.|:|..
Mouse  2039 MFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRY 2103

  Fly  2125 AGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRS 2189
            ||..||......:::||:.::||.||.|:.:.|||:|..::.||||.:::|.....:....|::.
Mouse  2104 AGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQE 2168

  Fly  2190 ALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKR--KPHYN--- 2249
            ..::.||.....:.|::||.|....|||..|:|..|:.|:..||.|..:..:..|  :|:||   
Mouse  2169 IREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVR 2233

  Fly  2250 --DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTV 2312
              .|||||::..||:|..:.:|.||.||:.|.:||..........|||:.||.:|.:||||:|:|
Mouse  2234 EFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSV 2298

  Fly  2313 MDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRT 2377
            |||||||||.:.||||:.:::.||||:.:|..|:||||||.|::|.:..||||.|::||||..|.
Mouse  2299 MDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRP 2363

  Fly  2378 NSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWY- 2441
             .:||..|..:|:|::..:|...:.....:.|:.:.:.:...|.|...:.||:|..|....:.| 
Mouse  2364 -KTEVEPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYS 2427

  Fly  2442 ---EIYFVFCIVWGFGSSLFQD--QIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFF 2501
               |:.|||.::|...:|:.:|  :.||       .:|.|.:. .||...|::.:|::   .|..
Mouse  2428 FMVEMTFVFSMIWSVCASVDEDGRKKID-------SYLREIEG-SFPNKDTVYEYYVN---PKMR 2481

  Fly  2502 PWTN----LVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAK 2562
            .||:    |...:....:.|....:|.|.:|.|..:.:.||:...:|::|:||.|:|||.:..:.
Mouse  2482 TWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSV 2546

  Fly  2563 LSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYF 2627
            |.:|||.::||..|..:..|||..:|.|:|..:||:....|.|.|.|.||.|:||:|||..|.:.
Mouse  2547 LQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFG 2611

  Fly  2628 TVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQ 2691
            :..|..|||.::||..||||.|.:::.|....::|.|.|..|..| |.||||..|....:..|::
Mouse  2612 SQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTE 2676

  Fly  2692 DALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTA-ITLHLKVVSSFLPTAIKFHYNFNLRDI 2755
            ..:..|..::::|    .:|.|::.| |...|:||.| :.::..||..||||..|.||.||||||
Mouse  2677 SQIIRIFGTMINQ----KLQDFEEEV-KPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDI 2736

  Fly  2756 ANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDV 2820
            :.:|.|:|.:|.:.......:.|||||||:||:.|:|||..|:.:|..|:||.:     |...|:
Mouse  2737 SKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKL-----GTFFDL 2796

  Fly  2821 VY------AQPLIYCHFAK------GLTDIKYMPISGWDRLKSLLDEAQDRYN--DYIGAMNLVL 2871
            .:      .:|.|:..|.|      .|.|:..        ||:.::.|.:.||  ..:..|.|||
Mouse  2797 TFHHLCPNKRPPIFGDFLKEPKVYEDLVDLTV--------LKTAMETALNEYNLSPSVVPMQLVL 2853

  Fly  2872 FDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANI 2936
            |.:|:.|:.||.|::...||..||:|:||||:|||.||||.|...:.|||::||.|...:.:.:|
Mouse  2854 FREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDI 2918

  Fly  2937 ATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLG 3001
            ..||.:|||:.....||..|:::|.|.||..:|::|:||::..|:..||.|.|.|.:.::.:...
Mouse  2919 KRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQ 2983

  Fly  3002 IVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSL 3066
            |.::.::.:.|.||:||:.|.:|||.||||...|...|::|||||||||:||.|||::||..|:.
Mouse  2984 IPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAE 3048

  Fly  3067 RFLSEITVLPKE-LALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEK 3130
            :::..:.:..:| :...|:.....:|.:|...|:..|...:||||.||.::|||::.|.|||.||
Mouse  3049 KYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEK 3113

  Fly  3131 VKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKI---KNQEADNLIIVVGTENEKVSK 3192
            .:..||:..:|..||.|:....::|:.:.  |::::.:.|:   :.|..:.|:|:|..:.|...:
Mouse  3114 RQELLDQANKLRTGLFKIDETREKVEVMS--LELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQ 3176

  Fly  3193 ERAFASKEEKNVRQIEE-DVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDA 3256
            ::|..:..||..  ||| ...|.|...::|..:|.|||..|..||.:|||.::.|:||:|.||..
Mouse  3177 QKAVTANSEKIA--IEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQ 3239

  Fly  3257 VVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAE 3321
            |..|..||::|   :|..|   :|...:..:|. ..|:.:|||:||.:|...|:|.:..|....:
Mouse  3240 VEIVMQAVMIL---RGNEP---TWAEAKRQLGE-QNFIKSLINFDKDNISDKVLKKIGAYCAQPD 3297

  Fly  3322 FSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELE 3386
            |.|:.|...|.||..||.||..:..:..:|.|||||...:..:..::::.:..|.....:|.|:.
Mouse  3298 FQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVA 3362

  Fly  3387 EQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGD 3451
            |:|..|:.:|||.||:|::.:.::.:....::.|..|:.|||.||.||.|:|:.|...:..|.||
Mouse  3363 EKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGD 3427

  Fly  3452 ILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLP 3516
            .||.:.|:||:|.|...||.|:..::|:...:..|.|......:|.|  :.:..::.:||.||||
Mouse  3428 CLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNF--LTNPTKVRDWNIQGLP 3490

  Fly  3517 SDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGT-GLVVLRLSQRNYLDQVERAVSNGSVL 3580
            ||..|.||..|:.:..|:.||||||.|.:||:|...|. ||.::.|...:||..:|.|:..|..:
Mouse  3491 SDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPV 3555

  Fly  3581 LIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTT 3643
            |::|:.|.:||.|||:|.:.:.:.|  .:::|||:|:::|..||..|.|||:||||.||..|:||
Mouse  3556 LLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTT 3620

  Fly  3644 LINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLE 3708
            ::||.|...|||.|||..||:.|||:||..:..|.......|..||.|||::|..|:.|..::|:
Mouse  3621 IVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLD 3685

  Fly  3709 DVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQF 3773
            ||.||..|:.:|.||.|:..::..::.|.:.||.|||||||.|:|||:::|:|||:.:|:|:|||
Mouse  3686 DVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQF 3750

  Fly  3774 SLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNL 3838
            ||.|:..:|..::.|:..:.||:||:|.|.|..|:..:.||.|.|||:.||:|...:|.:||...
Mouse  3751 SLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETS 3815

  Fly  3839 GEVEPTELDFLLRFPYMPNQTSNF-----TWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKK 3898
            |::...|.:|.||...:.::....     :||....|..|..|:....|.||....|...:.|..
Mouse  3816 GKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHL 3880

  Fly  3899 FVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTF 3962
            :..:.|||....||||:.. :.:||:.|:|.:|.||:::.:.|||...|||::|:...:......
Mouse  3881 WYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVM 3945

  Fly  3963 EESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHW 4027
            |:|:|.:.:.|:|||||||...:.:|.:..|.:   ..||::||||||..:|...:......|||
Mouse  3946 EDSTPRSPLVFILSPGVDPTSALLQLAEHTGMA---HRFHALSLGQGQAPIAARLLREGVNQGHW 4007

  Fly  4028 VILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPP 4091
            |.|.|.||...|:|:|:|.:|. .:.:.|.|:||:||:.|..|     .|..||:::||:|.|||
Mouse  4008 VFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPD-----FPISILQASIKMTTEPP 4067

  Fly  4092 TGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLT 4156
            .|:.||:.:.....::.....|||..::|.:||:||:||:::.||:||...|||..|.||..|..
Mouse  4068 KGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFE 4132

  Fly  4157 ISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEE----------FMQPEL 4211
            :|..:|..||:.....||:.|:||...:.||||:||||||||..||:.:          |.:..:
Mouse  4133 VSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSV 4197

  Fly  4212 IDGELEYCQGFPAPGILKYTGYHNYIDDNLPS-ESPSLYGLHSNAEIGFLTTVSERLFRIVFELQ 4275
            :|     ....|..|.|  ..|..|| ..||| :.|..:|.|.||::....|.:..||..:..||
Mouse  4198 LD-----TYYIPKDGSL--ASYKEYI-SMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQ 4254

  Fly  4276 PRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVE----DRSPYIIVAFQECERMN 4336
            |::|....||:  |:|:.:..:..|:..|.|   .:::..|..:    |.||..:|..||.:|.|
Mouse  4255 PQITPTRVGGQ--SREEKVLELAADVKQKIP---EMIDYEGTRKLLALDPSPLNVVLLQEIQRYN 4314

  Fly  4337 NLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRL 4401
            .||..:..||.:|:.|::|.:.:|:.:|::..|::...||..|.|: |||...|.||..||.:|:
Mouse  4315 KLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKV-YPSQKPLASWTRDLAVRV 4378

  Fly  4402 RELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPR 4466
            .:.|.|.:..|.|...||:||..|...|||::|..||:|...:|.:.....|:......|...|:
Mouse  4379 EQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDDSNLVYPPK 4443

  Fly  4467 EGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLR-G 4530
            :|.::.||::|||.||.|...:.:|...:|...||.::.:.....|:..|.:|.||.|....| |
Mouse  4444 DGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAG 4508

  Fly  4531 PT----FVWTFNLKSRERAS-KWTLAGVCLLL 4557
            .|    ||...:|:|....| .|...|..||:
Mouse  4509 STDRASFVIGIDLRSGSMTSDHWIKRGTALLM 4540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 127/611 (21%)
DHC_N2 1368..1770 CDD:285579 141/423 (33%)
P-loop_NTPase 1903..2132 CDD:304359 146/229 (64%)
P-loop_NTPase 2217..2352 CDD:304359 64/142 (45%)
P-loop_NTPase 2510..2783 CDD:304359 101/275 (37%)
P-loop_NTPase 2860..3127 CDD:304359 109/270 (40%)
MT 3140..3480 CDD:289543 110/344 (32%)
AAA_9 3509..3722 CDD:289547 95/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 240/708 (34%)
Dnah2XP_011247376.1 DHC_N1 275..842 CDD:285571 129/619 (21%)
DHC_N2 1340..1745 CDD:285579 141/419 (34%)
P-loop_NTPase 1882..2112 CDD:304359 146/230 (63%)
P-loop_NTPase 2198..2339 CDD:304359 64/141 (45%)
P-loop_NTPase 2498..2764 CDD:304359 101/271 (37%)
P-loop_NTPase 2849..3110 CDD:304359 107/261 (41%)
MT 3123..3455 CDD:289543 110/343 (32%)
AAA_9 3483..3699 CDD:289547 95/216 (44%)
Dynein_heavy 3841..4532 CDD:281078 240/713 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.