DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dhc16F

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_523394.1 Gene:Dhc16F FlyBaseID:FBgn0283476 Length:4081 Species:Drosophila melanogaster

Alignment Length:4455 Identity:1286/4456 (29%)
Similarity:2066/4456 (46%) Gaps:785/4456 (18%)


  Fly   353 SLIDCVNRTVE-----PDSIF---------QGDVDEAYKKLDINMQHLEYYKLIYNECRNSLKKF 403
            |||..:|..:.     ||..|         ..:....|...::..:.|..|:..|...|:     
  Fly   153 SLIPDLNLIINRMRNMPDDSFVYMDYMLPHDSEYFTPYSLREVEYKDLNTYEPFYTVTRH----- 212

  Fly   404 KIGTTFNSQDWTWH-QDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKGRQITFALEK 467
              |.||      || .:..|..||::....::...:.. :|.|                      
  Fly   213 --GVTF------WHCSENFFTPLDQWQQEFKQFLSIIQ-IRSF---------------------- 246

  Fly   468 ILEEYNSIYREWTNI----------QYNPIDPDAENSLF----QRDRLSFKAKTDVME-RMVSFQ 517
                  ||:|.|...          :.|......:|:||    |..:...:.::|::: :.::|.
  Fly   247 ------SIFRLWKGFKVWEKTIKWRKLNEARDYLQNNLFIVIPQLAKAILRMRSDIVQLQRLNFV 305

  Fly   518 FEKGLEDTHDLLLAGSLLLRPIIKKH--VEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLNE 580
            ....:|:.|...         .::.|  :...:|....||        :||| .|.:|.|     
  Fly   306 NVSNIENWHPFY---------FLETHMRIYEQLHKTFTDF--------REFI-AKTIFRA----- 347

  Fly   581 LPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKML 645
                 |...:...            |.:.:.|:..||.....|..:         ..:|...|..
  Fly   348 -----CTDAIQAR------------GFYPDDEVNYYPSLKKMREAH---------SFMDRARKRA 386

  Fly   646 LDKWTVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSV--------- 701
            ..|             |||            ||               |..||:.|         
  Fly   387 FCK-------------TLT------------NF---------------LTYCDMMVYQMLYRITK 411

  Fly   702 ----NLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQM---KPLLDF 759
                :|...|...||:..:...:           .:....:||        ||:|.   ||...|
  Fly   412 KSFEDLATSFEVHDEVGPSEADI-----------NKHDRVDKR--------IEKQRPQDKPQSPF 457

  Fly   760 IKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKD---LNPALLLH-- 819
                     |:.|:    :.|.||:     ::|..::.||.     :|||..   |...|.:|  
  Fly   458 ---------FLAML----RLLPDRI-----DIEPSEDIIRI-----IFQRITGLILETVLEIHPF 499

  Fly   820 -TDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISL 883
             |||                             ||   .:|:.|.....:|:...:|  .|.:..
  Fly   500 TTDP-----------------------------FF---TQYTQPSIMGRQEEVLYEG--APDLHY 530

  Fly   884 SVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDE 948
            .:...::|:..|:                          :.:.|:       |..:....:|...
  Fly   531 LLRADIRFQYNRK--------------------------NMFVLI-------RKAYERARLYTQR 562

  Fly   949 I--IAENLVDSVITSSTYLRMEVD--------NRYENNTPIFEIFMELQEPNVVYFRNLDTSSKT 1003
            .  |.||......|..|.|..|.|        :||.||....:..:|      ..|..|...::|
  Fly   563 FHQIRENFEIDNSTDPTVLNTERDLQILRAYCDRYCNNVRALDGILE------YVFLGLLKLTQT 621

  Fly  1004 GFAFFIETILDDMNNMM-SLLKRVAQDPTEVTNMNPYSFYDELQDKSEL----DKQRVEIMNKIK 1063
            .|...:..:...:.|:: :.|.::|::  |.|.:     |:|.||....    ..:.:||:..|:
  Fly   622 NFKDTVTPVCSRLQNVLATYLPKLAEE--ETTRL-----YEEAQDFHGRICYEPHETLEIVAHIR 679

  Fly  1064 LALQAVRVHGKGFMEFSSL---WIWDKSTYLSE----VKKFGRNLTLDERDAEADLEGSSGVKLL 1121
                        |::..|.   .|:|...|:.:    :|.||..:..|.::...|.|        
  Fly   680 ------------FLDKCSTELDGIFDGIDYVHDLLLIIKDFGIPIDDDSKEDYMDTE-------- 724

  Fly  1122 GLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLIN 1186
                                                                         |.:|
  Fly   725 -------------------------------------------------------------DYLN 728

  Fly  1187 RVKNSLKEL----QDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIID 1247
            |.:.:|:|:    |||::...     :..:||...|            |:.|::       ..|:
  Fly   729 RTRETLEEIREKRQDFINRLE-----DAMQDDIAAL------------KEDIHE-------VAIE 769

  Fly  1248 LLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRK 1312
            .|:.:..:.....|:..|:|.....::.:...|..:.:...:.:|:||     .:.|.||:.:  
  Fly   770 ALQPWLLDANSNRLSVTNKLDSMLERLNKCRETADEFLGYQKEFQIDL-----TMYDEMASGF-- 827

  Fly  1313 KFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKI 1377
                                                                     :|:::.: 
  Fly   828 ---------------------------------------------------------YDIRMRQ- 834

  Fly  1378 MWDFAITIQSTINDWKKT--PWKKIDIENMD------------QECKKFGRELRGLDKAMRTWEP 1428
                  .:..|.:||:::  .|...|...::            :.|.:|.:.|.         |.
  Fly   835 ------NLYRTWSDWEESLAEWIVSDFNTLNVVDMVELNSKTIKNCMQFQKYLP---------EN 884

  Fly  1429 FI--FMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYE- 1490
            .|  .::.|.:.....|..:..|:||.:|.|||.|:......||..:....::...|  :|.:: 
  Fly   885 NIVPVLQKSAEAFKEKLPVIGYLRNPNLRARHWAEIEDLLNRKFFQEKDILIQTYED--VHAFDD 947

  Fly  1491 ----EEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFG-TDIHDRTSIKLLKASEELIETLEDHQG 1550
                |.:..|..::..|:.:|..|:.|.|.|...|.. ...||...:.:|..:|||...|:|...
  Fly   948 VAIGEALMQISSQATGEVQLENMLKGIETTWKETELSIVPHHDAKDVFILAGTEELQAVLDDSNV 1012

  Fly  1551 QLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRR 1615
            .:..:|:||::...:.:|..|.|.:....:...||.:.|..|.|||:|| .|.||:.|||.:::.
  Fly  1013 NINTIAASKFVGPIKSKVDEWINAMDQFAKTFESWMDCQGAWIYLEAIF-ASADIQRQLPHEAKM 1076

  Fly  1616 FDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFY 1680
            |..:||.||..:.|  |.:..:.....|...:::.|....::|.|..:.|..|||.||:.:||||
  Fly  1077 FFTVDKSFKETVRQ--AKKVALALPTMSSVDVHKVLVENNRLLDLISRGLEAYLEVKRVVFPRFY 1139

  Fly  1681 FVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAG--MVAKELEEYVPFL----- 1738
            |:|:.:||:||:....|..|..||.|.:|::.:|..  |||....  |||  ..:.|.||     
  Fly  1140 FLSNDELLEILAQTRIPQAVQPHLRKCFDAIYRLEF--GSKEGGDGKMVA--TNDIVAFLSPEGE 1200

  Fly  1739 -----ENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMW 1798
                 :.....|.||.||:::.:.|..:.:..::.....|..|.|..|..:.|.|..|..:|:.|
  Fly  1201 KLQFGKGLKARGAVEEWLSKVEEAMFVSCKRYMRFGYQCYPAKEREDWFQDHPNQVVLTVSQVQW 1265

  Fly  1799 TTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMT-----IC---TIDV 1855
            ..:.:..:...::...|.|:...|.:|..|.:     ||.|.|..|:.|.:     :|   ||||
  Fly  1266 AADIHRIYEGKERNPLNILEKMAKFEIKCLKD-----LGALAALTRKNISSLLRKILCALITIDV 1325

  Fly  1856 HSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLT 1920
            |::|.|..:|.|:|...:.|.|...||..|..:.:..::.:..|...|.|||||....||:||||
  Fly  1326 HAKDSVRMLIEKEVCKASDFNWLKMLRFYWADETETVYSRMAAANIPYYYEYLGAGGVLVLTPLT 1390

  Fly  1921 DRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQ 1985
            ||||:.|..:..:.:|||||||||||||||||||.:||.....|||||:.:|||.:|....||||
  Fly  1391 DRCYLCLMGAFQMDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKMMGRFFSGLAQ 1455

  Fly  1986 TGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGR 2050
            .|||.||||||||.:|||||:|.|:..|:.|...:.:.|.|.|..|.:..:..||||||||||||
  Fly  1456 CGAWCCFDEFNRIDIEVLSVIAQQLITIRTAKAMRVKRFIFEGREIKINRSCCVFITMNPGYAGR 1520

  Fly  2051 AELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGL 2115
            .|||:|||||:||.:|:|||:|||||::|.:|||::.::||||.:.:|.||.:.||:|:|||:|:
  Fly  1521 TELPDNLKALFRPISMMVPDYALISEVILYSEGFEDPKILARKMVQMYQLCSQQLSQQNHYDFGM 1585

  Fly  2116 RAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNP 2180
            ||:|||||:||||:|....:.||..|:.||||.||||.:.||..:|.|::.||||.:::|..::|
  Fly  1586 RAVKSVLVMAGALKRASPNQREDITLIAALRDSNIPKFLADDAVLFRGILSDLFPGVELPDSQHP 1650

  Fly  2181 EFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWK----TLNKTYQN 2241
            ..||.::.......||.....|.|.:||.|...||..|.::|..|.|||.|..    .|:..::|
  Fly  1651 HLEASLRLGLRQKNLQAVPTTIRKCLQLYETMCVRWGVMLVGPTGGGKSVVLHALEFALSHLFEN 1715

  Fly  2242 QKRKPHY-----NDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDI 2301
            :.:.|::     ..:||||||.:||:|.|:..|.||:|||..:.:|....:.....:||:.||.:
  Fly  1716 EVQDPNFRPVVIQTMNPKAVTMNELYGYVDLKTLEWQDGLLGLAVRTATTVEDEIHQWIMCDGPV 1780

  Fly  2302 DPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWT 2366
            |.:|||:||||:||||:|.||::|||.||..:.:|||:..|..|:||||||.|::|::|.||||.
  Fly  1781 DAVWIENLNTVLDDNKMLCLANSERIKLTAWIHMLFEVQDLLQASPATVSRCGMVYVDPGDLGWI 1845

  Fly  2367 PFIQSWLGTRTNSSEVSMLN-----------VLFDKYVPPLLDIFRTRLRSITPISDI--ARLQM 2418
            |.|.:|       .||.|.:           .||..|....|.|  .|.|::..|..:  :::::
  Fly  1846 PLIDTW-------REVDMKHKLPAPLAEFCYQLFVGYFDKALKI--ERKRAVYTIHQVLGSKVRL 1901

  Fly  2419 TCYLLDSMLTP---QNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAV 2480
            .|.|..:....   ..:..:..|:.....|.:.::|...|:|...:.:.:..::|| .:.::..:
  Fly  1902 CCELNSAQFEAVKWSAMSEEQGKELVTKIFAWAVLWAIASNLKDAEKVSFEEQWSK-AIAQHPNM 1965

  Fly  2481 KFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPL 2545
            ..| :.|::::.||.|...:..|.:::.:|..|.:.......|.|.:||:..:..|.|.:...|:
  Fly  1966 TLP-NFTLWNYRIDLEKMDWGSWIDIMAKFVFDPETSYYDMQVPTVDTTKYGYVSDLLFKRGMPV 2029

  Fly  2546 MLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYG-PIGNK 2609
            |:.|.:|.|||:|..:.:..|.........:.|:..|:|...|.::|.||||:.....| |:| |
  Fly  2030 MVTGDTGVGKTVLAISCMKRLSQGNVIPVILNFSAQTSSNRTQEMIEGPLEKRKKTQLGAPVG-K 2093

  Fly  2610 RMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIV---ACMNPSAGSF 2671
            .:|.|:||:|||::|.|.......|:|||:|:..:|||:|:..::|  .::|   ||..|..|..
  Fly  2094 TVIVFIDDVNMPKLDTYGASPAIELLRQFLDFKGFYDREKLYWKEI--LDVVLGCACAPPGGGRN 2156

  Fly  2672 TIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVV 2736
            .:.||..|||..|::..|:::.|..|.|.||...    :|.|..||..|.|.||...:.::::|.
  Fly  2157 PLTPRFVRHFALFSLPKPNEETLTQIFNGILRGF----LQTFSSAVRALSEPMVNACVDVYMRVA 2217

  Fly  2737 SSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSF 2801
            :..|||..|.||.|||||::....|:|.:::......||::||:.||..||:.|:|::..|.|.|
  Fly  2218 TVMLPTPDKSHYIFNLRDLSKCIQGILQASNLHYNQENQILRLFYHETTRVFHDRLINIEDKNIF 2282

  Fly  2802 KKIVSDIVRKGIEG--VNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDR----- 2859
            |.::.::.......  :||:   ..|:::..|.          :.|..:.:.:.||.:|.     
  Fly  2283 KALMKEVCMDHFNRPVINDN---EPPILFGDFM----------VFGKPKNERIYDEIRDHTKLES 2334

  Fly  2860 -YNDYIG---------AMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFIS 2914
             .||||.         .|.|:||.|||.|..|::|:|.|.||..||:||.|.||||||||||.::
  Fly  2335 VLNDYIADYNSVAVGKQMKLILFQDAMEHTVRLARLLRSDRGNGLLVGVAGMGKQSLTRLASHVN 2399

  Fly  2915 SLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHE 2979
            ..:.:||::.::|.::....::..||..||:......||:.||::..|:||..:|::|.||::..
  Fly  2400 EYNCWQIEMRRNYDLNAFHEDLRVLYRIAGIDNQPVTFLLIDSQIVEEEFLEDINNILNSGEVPN 2464

  Fly  2980 LFPDDEVENIVNAVRNEVKQLGIVDN-------RENCWKYFIEKVRSLLKVVLCFSPVGATLRVR 3037
            ||..||.|.|:...|:     |..:|       |::.:|:||.:||:.|.||:..||||...|.|
  Fly  2465 LFEGDEFEKIILDARD-----GCNENRKDDPCTRDDIYKFFINRVRNNLHVVMSMSPVGDAFRRR 2524

  Fly  3038 SRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPK-ELALPVSNFMAFVHKTVNDISKLY 3101
            .|.||:||||||||||..||.:||.||:|..|::|.  || |..:.:::...|:||||.|.|..:
  Fly  2525 CRMFPSLVNCTTIDWFTSWPTEALYSVALGLLTKIA--PKMEDRISLASTTVFMHKTVEDASVKF 2587

  Fly  3102 LANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQE 3166
            ....||:.||||.|:|||:.||..||..|....:.:|.|:.|||.||....:.:..:...|:|..
  Fly  2588 YKEMKRHYYTTPSSYLELLKLYQNLLKIKNMEIIAKRKRIANGLNKLLETNEVIAVMGKELEVMV 2652

  Fly  3167 VELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQ--IEEDVTAK-----AKLCEEDFLK 3224
            .:|..|:....:|:       :.::||    :|:...|:|  :|:::.||     |:...||..|
  Fly  2653 PQLDEKSAMMKSLV-------DNLTKE----TKQADAVKQSVLEDEMNAKEKAAVAQAISEDAGK 2706

  Fly  3225 ----AQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVC-GAVLVLFSSKGKIPKDRSWKACR 3284
                |.|||..|:|||..|.|.::.|||||.:|| |:|..| .||.:|...|      .:|.:.:
  Fly  2707 DLEIAMPALREAEEALKGLTKADINELKSFTTPP-ALVQFCMEAVCILLGVK------PTWASAK 2764

  Fly  3285 AFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYD 3349
            |.|.::: |:..|..|||:|:..|.:|.::.||...:|.|.|....|..|..:..|||::::|..
  Fly  2765 AIMADIN-FIKRLFEYDKEHMKEDTLKKVKKYIDHKDFVPAKFEKVSKVAKSMSMWVISMDKFSK 2828

  Fly  3350 VYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTA 3414
            ||.|||||.:....:|.|:|:....|......|..:|.::..|:...:|...:.|..||....|.
  Fly  2829 VYKVVEPKIKRKEAAEAELKEVMTVLRQKQKELAAVEAKIQGLRDSLEEKQREFQVIQDNVDLTY 2893

  Fly  3415 FTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWM 3479
            ..|:.|.||...|:.|::||.|:||.||..:..:|||:|:.:..::|:|.|:..||::: ..||:
  Fly  2894 GRINRAGRLTSALSDEQVRWRETVKSLTGDLACVPGDVLVAAACVAYLGAFSHEYRRDM-SALWV 2957

  Fly  3480 PAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQG 3544
            .  |..:..|||:...:..:::.|..::.:||..|||.|.:|.||.....::.|:.||||||.|.
  Fly  2958 S--KCREHKIPSSPEFNLLKVLGDPYEMRQWNVDGLPKDNISIENGIYATRALRWALMIDPQEQA 3020

  Fly  3545 IKWVKT-KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIK-KG-T 3606
            .:|::. :....|.|::::....:..:|.||..|..:|:|.|.|.|||.|.|:|.|:..: :| |
  Fly  3021 NRWIRNMERANNLQVIKMTDSTMMRVLENAVRQGYPVLLEEINETIDPSLRPILQRETYRFEGRT 3085

  Fly  3607 VLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLE 3671
            .||:||..||::..|:|.:.|||.||||.||:....||:||.||..||||||||::|.:|.|.:|
  Fly  3086 YLKLGDMVIDYDDNFKLYMTTKLPNPHYLPEVCINVTLVNFLVTESGLEDQLLADIVAIELPAME 3150

  Fly  3672 AMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKIT 3736
            ..|..|..:.|..|..|..|||.:|..|.::..|:|:|..||..|...|:|:..|..::.:.:.|
  Fly  3151 IQRNDLVVKINSDKQQLLALEDKVLKLLFNSEGNILDDEELVETLNDAKETSLIIAARLIDTEET 3215

  Fly  3737 GVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVEN 3801
            ...|.::||.||..|.|.:|:||::..|.:|:|:||:|||.||.||.|.:......:.::.|:..
  Fly  3216 EKVITASRERYRILASRGAILYFVVAGLAEIDPMYQYSLKYFTQVFCNVLRLDHPPQSVEVRIST 3280

  Fly  3802 LIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFP-------YMPNQT 3859
            |:.......|...||||||..|:||...|.:.:....|.|...|..||.|.|       ..|.:.
  Fly  3281 LMTDELRAIFDNISRGLFENHKIIFSFLLALSVERQEGRVTEEEFLFLSRGPVGNIRTKIQPAKI 3345

  Fly  3860 SNFTWLTHVGWGGIRAL--NNQAVFKGLEKDIE-------GSHKRWKKFVDSESPENEKFPGEW- 3914
            .    ::.:.|.....|  |..:.|.||..:::       ..:|....|..:..|..:|    | 
  Fly  3346 K----MSQIEWDSCIFLEDNFSSFFSGLTDELDKPFFIQMQENKEVFDFAQTNQPPTDK----WN 3402

  Fly  3915 KGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDAR-SMEFSRTFEESSPETHIFFVLSPG 3978
            |......:|..:...|..|....:..:::..:|..:.:|. ..:.|..:.::|..|.:.||||.|
  Fly  3403 KRLRVFHKLMFISAFRKPRFLLNVVCYLQSTVGKYFTEASGGTQLSSVYLDTSAVTPLIFVLSTG 3467

  Fly  3979 VDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSL 4043
            .||:....|....:.|:   :.::|:||||||..:|||.||.:.:.||||.|||.||...::.:|
  Fly  3468 SDPMSGFLKFTTQMQFT---DKYYSISLGQGQGPLAENLIEKSLRLGHWVFLQNCHLATSFMQTL 3529

  Fly  4044 E---KKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNF 4105
            |   :.:...::..|..:||:||:.|     ....|..:|::::|||||||.|:.||:..||.:.
  Fly  3530 ETIVRNLTLGITKAHVDFRLYLSSMP-----IQTFPISVLQNSVKITNEPPKGIKANVFGALTDL 3589

  Fly  4106 SDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL--EA 4168
            ..:..|...:...::||:|.||.||||:.|||||||.|||.:|.|:..|....:..|..::  |.
  Fly  3590 KQDFFEQHIQNGNWRAIVFGLCMFHAVLLERRKFGPLGWNITYEFSESDRECGLKTLDFFIDREV 3654

  Fly  4169 NTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG---FPAPGILKY 4230
            ...:|||.:.|:.|:|.:||.:||.||.|..||.|..|....:|..:.:||:|   :..|.....
  Fly  3655 LDEIPWEAILYINGDITWGGRVTDYWDLRCLRTILTIFSSKRIIQPDYKYCRGDSYYRDPRKKTL 3719

  Fly  4231 TGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTG--GSSGGETVSQEDI 4293
            |.|..|:......|.|.::|::.||.|.|.|..:......:...|||...  |.:....::|:.|
  Fly  3720 TEYSAYVQGFPVLEDPEIFGMNQNANIVFQTKETAFFINTLLLGQPRSAADEGQAMENEIAQQTI 3784

  Fly  4294 --IKNIIEDILDKTP--TPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLK 4354
              |:..:...:.:.|  ...::|:..|:|...:   ||..||.:|.|..:..:..||..|...:|
  Fly  3785 ARIQKALATKIKREPIHDTLSVLDAKGQVPSLT---IVLVQEIDRFNIALGIIHDSLVNLSKAIK 3846

  Fly  4355 GELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWL 4419
            |.:.:|..:|::...|..:|||..|.|.::.|:..|.|:.||...|:..::.| |:...|.|.|:
  Fly  3847 GLVVMSEELENVFKALLSNQVPASWAKRSFLSIKPLPSYISDFQRRIDFIQQW-AENGAPRSYWI 3910

  Fly  4420 AGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKK-------WKEELTTAPREGAY------- 4470
            :|||.|||.||.::|..||:...|:|.:.::.||.::       ::........:..|       
  Fly  3911 SGFFFPQSFLTGVLQTYARRRVLPIDSLKIDFDVFERELVQQDFFEMHTNNMSDQKLYGNLPECT 3975

  Fly  4471 -----INGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLR- 4529
                 ::|:|:|.||||:..|.:.||...|||..|||:..|...:....::  ||.|:||.:.| 
  Fly  3976 DAIINVHGIFIEAARWDLSKGGLCDANFGELFSRMPVVRFKPCLEISPTVR--YEAPLYKTQQRS 4038

  Fly  4530 --------GPTFVWTFNLKSRERASKWTLAGVCLL 4556
                    ...|:....|:|......|.:.|..|:
  Fly  4039 GVLSTTGHSTNFILAVLLRSHNDPEFWIMRGTALV 4073

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 75/458 (16%)
DHC_N2 1368..1770 CDD:285579 112/436 (26%)
P-loop_NTPase 1903..2132 CDD:304359 136/229 (59%)
P-loop_NTPase 2217..2352 CDD:304359 61/144 (42%)
P-loop_NTPase 2510..2783 CDD:304359 93/277 (34%)
P-loop_NTPase 2860..3127 CDD:304359 120/284 (42%)
MT 3140..3480 CDD:289543 112/352 (32%)
AAA_9 3509..3722 CDD:289547 89/216 (41%)
Dynein_heavy 3864..4549 CDD:281078 214/738 (29%)
Dhc16FNP_523394.1 DHC_N2 829..1234 CDD:285579 112/430 (26%)
P-loop_NTPase 1373..1603 CDD:304359 136/230 (59%)
P-loop_NTPase 1687..1832 CDD:304359 62/145 (43%)
P-loop_NTPase 1994..2264 CDD:304359 93/277 (34%)
P-loop_NTPase 2343..2613 CDD:304359 116/277 (42%)
MT 2625..2957 CDD:289543 112/352 (32%)
AAA_9 2985..3201 CDD:289547 89/216 (41%)
Dynein_heavy 3342..4066 CDD:281078 215/746 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93507163
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.