DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah2

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_006220764.1 Gene:Dnah2 RGDID:1565087 Length:4508 Species:Rattus norvegicus

Alignment Length:4756 Identity:1483/4757 (31%)
Similarity:2434/4757 (51%) Gaps:510/4757 (11%)


  Fly     1 MADEKEKKEP---VDNRPEFFWNYLTKTMRLKL--DKWTKMITTNEFRDVIIE-FLNNPNKKRII 59
            :.:.:|.|||   .|.:|.|    |::.|...|  ..||..      .|.::| |..:|:...:.
  Rat    60 LEEPEEPKEPDLSTDVKPIF----LSRAMLTGLADSTWTAE------HDAVLEHFAQDPSVPVLT 114

  Fly    60 FTINSGGQLYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVF 124
            ..::....|......||:.:.::.||||. .|:.:|.||...::..|.:....:..|..|...|:
  Rat   115 IFVDPVFGLKLELGMPVQTQNQIVYFIRQ-APVPITPENFEETVQYGTVRGAYIPALLRLLSGVY 178

  Fly   125 FP--LLNNTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLP---ICMDEVMQAAPA 184
            .|  .:|.:     |...|.|...:........:...:..:...|:..:|   |.||      ||
  Rat   179 VPQIFMNKS-----WPESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEAITMD------PA 232

  Fly   185 IAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENF-PLPEAIFSFWESRLENLE 248
            :.:.|..:|     ..||..::.|...::::  :.|.|.:.:.||. ||.|  ..||.:|..:|.
  Rat   233 VVIKDKELV-----QRLETSMIHWTRQIKEV--LSAQESVDTGENLGPLEE--IEFWNNRCMDLS 288

  Fly   249 NLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLK---RKMDKFET 310
            .:::||..:.:|.|..:|...:|.:...:|::.:.:.:...:|:.....||.|:   :::...:.
  Rat   289 GISKQLVKQGVKHIESILLLAKSSYLAPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKP 353

  Fly   311 NDMDENRSDIRPLMLT-IGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDE 374
            .|:    ||..|.::: |.::|.:|.:::|...:|..|....|.:|.....:|..|.||:|.|..
  Rat   354 KDI----SDKLPKLISLIRIIWVNSPHYNTRERLTGLFRKMSNEIIRLCCHSVSLDRIFEGYVSS 414

  Fly   375 AYKKLD--INMQHL--EYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEEL 435
            :.:.|.  |:..|.  |:|          |:..::.|.|:::.|...|..||.::|.|:.|.::|
  Rat   415 SKEDLQGCISCCHAWKEHY----------LRAVQMHTQFSNRGWVLDQTSIFAQVDAFVQRCKDL 469

  Fly   436 KDLFNTVRDFQKLEKIVMG------GLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENS 494
            .::.:....|.:......|      |.:|.|||..|.:|.:.::...:....::...:  |.:|:
  Rat   470 IEVCDCQYHFARWLDGTQGPLPCFFGAQGPQITRNLLEIEDIFHKNLQTLRAVRGGIL--DVKNT 532

  Fly   495 LFQRDRLSFKA---KTDVM-ERMVSFQFEKGLEDTHDLLLAGSL--------LLRPIIKKHVEPL 547
            .:..|...|:|   ..:|| :.:::..||...:..|.:||..:.        ::|...||.|:..
  Rat   533 SWHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRLANREAIMRTYEKKAVDLY 597

  Fly   548 MHVIVDDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRI-------I 605
            |.     |..|:..|.:| :|.|..:         .:....:.||...:::.||.||       .
  Rat   598 ML-----FNSELALVNRE-LNKKWPY---------LEPYMAQYSGQAHWVRILRRRIDRVMNCLS 647

  Fly   606 GLH-------KEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTV----ECWQGIQQ 659
            |.|       .|..::.|               ..|||.||:..:....:||.    :|.:.:  
  Rat   648 GAHFLPHIGTGEETVHTY---------------QQMVQAIDELVRKTFQEWTATLDKDCIRRL-- 695

  Fly   660 DITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIA 724
            |:.|..|.:::|..|.|||.:.|:....:|.....|..:....:.....|.::|...|..|:.:|
  Rat   696 DMPLLRISQEKAGMLDVNFDKTLLILFVEIDYWERLLFETPHYVMNVADRAEDLRILRENLLLVA 760

  Fly   725 EWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKW-----NAFSQRFI----VMIFKMVKYL 780
            ..||.......|.|:.|....:..:::::.|.|..:.|     :||   ||    :...|:...:
  Rat   761 RDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWALKGASAF---FITECRIHASKVQMIV 822

  Fly   781 HDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLM 845
            :|           .|.|..:.|    ::.::::..||:|...::....:....|....|:.....
  Rat   823 ND-----------FKASTLTIG----WKAQEMSELLLVHITGKQVYRDLEFEEAQREHRMAVQQK 872

  Fly   846 YVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEE 910
            .|||                                            .::||:           
  Rat   873 LVNL--------------------------------------------HQDVIN----------- 882

  Fly   911 QSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEV--DNRY 973
                   |:|  :.:|:.|....|.:..:..|.|.:|.::.:.|..:|..|...|...:  |.:.
  Rat   883 -------ILT--NSFEVFKNDGPEIQQQWLLYTIRLDHMMEDALRLNVKWSLLELSKAINGDGKT 938

  Fly   974 ENNTPIFEIFMELQEPNVVYFRNLDT---SSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTN 1035
            ..| |:|.:.:.||.         |.   .::..|:..::|:...:|::.|.|         .:.
  Rat   939 SPN-PLFRVLVILQS---------DVQGGGAQVEFSPTLQTLASVVNDIGSHL---------FST 984

  Fly  1036 MNPYSFYDELQDKSELDK-------QRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSE 1093
            ::.:....::..|.::.:       :|.|.:.||:..:.:...:....:: :.|..||....:.|
  Rat   985 ISVFRHLPDILTKRKMTREPIHVVVERDEDIRKIQAQISSGMTNNASLLQ-NYLKTWDMYREIWE 1048

  Fly  1094 VKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFL 1158
            :.|                  .|.::......||:|.:...:.::.|:.:.::..||..: ..|:
  Rat  1049 INK------------------DSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLN-IQFV 1094

  Fly  1159 RLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFV-DEANIVLKIELQKDDFEGLVKIL 1222
            .|:.:..|.:::....:|.:.|...|.......|.:|..:: |.|.   ||.......|.|...|
  Rat  1095 MLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLMDLHTYLKDNAE---KISRPPQTLEELGVSL 1156

  Fly  1223 SVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAP 1287
            .:::.:.......::...|:.|...:|.:|.....||.|..:..|...|:..:::...::|::..
  Rat  1157 QLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKK 1221

  Fly  1288 -IQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLE-------------- 1337
             .:.::..||        :.|:.::||             .:.|:::.:|:              
  Rat  1222 HKEKFKTGLI--------HAADDFKKK-------------AHNLLEDFELKGPFTSNVGHTAALD 1265

  Fly  1338 --------LVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKK 1394
                    |:|:.|.:.:|..:..:|:::.|....::....:|..::.:|:.....:.:.|.||.
  Rat  1266 QIAQVRAMLMAMREEESNLRSNLGIFKIEQPISKDLQNLEKELDALQQVWEITRDWEESWNQWKT 1330

  Fly  1395 TPWKKIDIENMDQECKKFGRELRGLDKAM--RTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDR 1457
            ..:..:..|.|:.......|.|..|.|..  |.||......|.::....::..:::|:|||:|:|
  Rat  1331 GCFLTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEVIETTRAKIEQFKRTMPLISDLRNPALRER 1395

  Fly  1458 HWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTME 1521
            ||.::.:..:.:|..: :|.||:.::.|.:.::.|::..|...:.||:|:|..|::||..|.:.:
  Rat  1396 HWDQVKEEIQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQ 1460

  Fly  1522 FGTDI-------HDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNAD 1579
            .  ||       |.|     |:.:||:.:.|||:|..|..|.:|:::..||.:|..|:..||...
  Rat  1461 L--DIVPYKDKGHHR-----LRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLIL 1518

  Fly  1580 QIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG 1644
            ::|.....|||:|.|||:||:| ||||.|||.:|..||.::..:|.::.:||.|.|.:|||:..|
  Rat  1519 EVIEMVLTVQRQWMYLENIFLG-EDIRKQLPNESALFDQVNNNWKGIMDRMNKDNNALRSTHYPG 1582

  Fly  1645 SKLYEHLEILLKMLLLCE---KALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTK 1706
            .     ||.|::|..:.|   |:|:.||||||..:|||||:|:.|||:||....||..|..||.|
  Rat  1583 L-----LETLIEMNTILEDIQKSLDMYLETKRHMFPRFYFLSNDDLLEILGQSRNPEAVQPHLKK 1642

  Fly  1707 LYDSMG--KLNLISGSKN---AAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQL 1766
            .:|::.  |:..:.||.:   |.||.:.: .||:.||......|.||.||..:...||.||||.|
  Rat  1643 CFDNIKLLKIQKVGGSSSKWEAVGMFSGD-GEYIDFLHPVLLEGAVESWLGDVERAMRMTLRDLL 1706

  Fly  1767 KR---SLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQITQ 1827
            :.   :|..:.:| |..|:.:|..|..:..:||.||.:........::|.: ..||...|||::.
  Rat  1707 RNCRMALKKFLNK-RDKWVKDWAGQMVITASQIQWTADVTKCLMTAKERSDKKILKVMKKKQVSI 1770

  Fly  1828 LNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDC 1892
            ||.....:.|:||...|.||:.:.||::|:|||:..:....:....||.|.||||..|:..:|||
  Rat  1771 LNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKGGLMDVNAFDWLSQLRFYWEKDVDDC 1835

  Fly  1893 FANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRA 1957
            .....:.||:|.||||||:.||||||||||||:|||.:|||..||:|.||||||||||.||||:|
  Rat  1836 IIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKA 1900

  Fly  1958 LGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQ 2022
            ||..|.|.||||.:||||:|.::.|||||||||||||||||::|||||||.|:..|..|:.:...
  Rat  1901 LGTYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLT 1965

  Fly  2023 TFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEA 2087
            .|.|.|..|.|..:.|:|||||||||||.|||||||:::||.||||||..||:||:|..|||...
  Rat  1966 RFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNC 2030

  Fly  2088 RLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPK 2152
            ::||:|..|||:|..:.||:|||||:||||:.|:|..||..||......:::||:.::||.||.|
  Rat  2031 KILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAK 2095

  Fly  2153 IVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHS 2217
            :.:.|||:|..::.||||.:::|.....:....|::...::.||.....:.|::||.|....|||
  Rat  2096 LTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHS 2160

  Fly  2218 VFIIGFAGTGKSEVWKTLNKTYQNQKR--KPHYN-----DLNPKAVTNDELFGIVNPSTREWKDG 2275
            ..|:|..|:.|:..|:.|..:..:..|  :|::|     .|||||::..||:|..:.:|.||.||
  Rat  2161 TMIVGGTGSSKTTSWRILQASLTSLCRAGEPNFNIVKEFPLNPKALSLGELYGEYDLNTNEWTDG 2225

  Fly  2276 LFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIA 2340
            :.|.:||..........|||:.||.:|.:||||:|:||||||||||.:.||||:.:::.||||:.
  Rat  2226 ILSSVMRAACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVE 2290

  Fly  2341 SLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLR 2405
            :|..|:||||||.|::|.:..||||||::||||..|. .:|:..|..:|:|::..:|...:....
  Rat  2291 NLAVASPATVSRCGMVYTDYVDLGWTPYVQSWLEKRP-KAEIEPLQRMFEKFINKILTFKKDNCN 2354

  Fly  2406 SITPISDIARLQMTCYLLDSMLTPQNVPNDCPKD------WYEIYFVFCIVWGFGSSLFQD--QI 2462
            .:.|:::.:.:...|.|...:.||:|..|  |.|      ..|:.|||.::|...:|:.:|  :.
  Rat  2355 ELVPVTEYSGIISLCKLYTVLATPENGVN--PADTENHAFMVEMTFVFSMIWSVCASVDEDGRKK 2417

  Fly  2463 IDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQ-FELDMDLPLQSNLVNTA 2526
            ||       .:|.|.:. .||...|::.:|::.:.:.:..:...:|: :....:.|....:|.|.
  Rat  2418 ID-------SYLREIEG-SFPNKDTVYEYYVNPKMRTWSSFEEQLPKSWRYPPNAPFYKIMVPTV 2474

  Fly  2527 ETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRIL 2591
            :|.|..:.:.||:...:|::|:||.|:|||.:..:.|.:|||.::||..|..:..|||..:|.|:
  Rat  2475 DTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSII 2539

  Fly  2592 EKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIH 2656
            |..:||:....|.|.|.|.||.|:||:|||..|.:.:..|..|||.::||..||||.|.|::.|.
  Rat  2540 ESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQTIKHIR 2604

  Fly  2657 KCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKL 2720
            ...::|.|.|..|..| |.||||..|....:..|::..:..|..::::|    .:|.|::.| |.
  Rat  2605 DMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQ----KLQDFEEEV-KP 2664

  Fly  2721 CENMVTTA-ITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHEC 2784
            ..|:||.| :.::..||..||||..|.||.||||||:.:|.|:|.:|.:.......:.|||||||
  Rat  2665 IGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHEC 2729

  Fly  2785 YRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVY------AQPLIYCHFAK------GLTD 2837
            :||:.|:|||.||:.:|..|:||.:     |...|:.:      .:|.|:..|.|      .|.|
  Rat  2730 FRVFSDRLVDTTDMEAFIGILSDKL-----GTFFDLTFHHLCPNKRPPIFGDFLKEPKVYEDLVD 2789

  Fly  2838 IKYMPISGWDRLKSLLDEAQDRYN--DYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGG 2900
            :..        ||:.::.|.:.||  ..:..|.||||.:|:.|:.||.|::...||..||:|:||
  Rat  2790 LSV--------LKTAMETALNEYNLSPSVVQMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGG 2846

  Fly  2901 SGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFL 2965
            ||:|||.||||.|...:.|||::||.|...:.:.:|..||.:|||:..|..||..|:::|.|.||
  Rat  2847 SGRQSLARLASSICEYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQATSFLFVDTQIADESFL 2911

  Fly  2966 VLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPV 3030
            ..:|::|:||::..|:..||.|.|.|.:.::.:...|.::.::.:.|.||:||:.|.:|||.|||
  Rat  2912 EDINNILSSGEVPNLYKADEFEEIQNQIIDQARAEQISESSDSLFAYLIERVRNNLHIVLCLSPV 2976

  Fly  3031 GATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKE-LALPVSNFMAFVHKTV 3094
            |...|...|::|||||||||:||.|||::||..|:.::|..:.:..:| :...|:.....:|.:|
  Rat  2977 GDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYLVGVDLGTQENIHRKVAQIFVTMHWSV 3041

  Fly  3095 NDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQ 3159
            ...|:..|...:|:||.||.::|||::.|.|||.||.:..||:..:|..||.|:....::|:.:.
  Rat  3042 AQYSQKMLLELRRHNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMS 3106

  Fly  3160 DVLKVQEVELKI---KNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEE-DVTAKAKLCEE 3220
              |::::.:.|:   :.|..:.|:|:|..:.|...:::|..:..||..  ||| ...|.|...::
  Rat  3107 --LELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIA--IEEVKCQALADNAQK 3167

  Fly  3221 DFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRA 3285
            |..:|.|||..|..||.:|||.::.|:||:|.||..|..|..||::|   :|..|   :|...:.
  Rat  3168 DLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMIL---RGNEP---TWAEAKR 3226

  Fly  3286 FMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDV 3350
            .:|. ..|:.:||.:||.:|...|:|.:..|....:|.|:.|...|.||..||.||..:..:..:
  Rat  3227 QLGE-QNFIKSLIYFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRL 3290

  Fly  3351 YLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAF 3415
            |.|||||...:..:..::::.:..|.....:|.|:.|:|..|:.:|||.||:|::.:.::.:...
  Rat  3291 YRVVEPKRIRMNAAIAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMEL 3355

  Fly  3416 TIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMP 3480
            .::.|..|:.|||.||.||.|:|:.|...:..|.||.||.:.|:||:|.|...||.|:..::|:.
  Rat  3356 KLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIVNQIWIK 3420

  Fly  3481 AFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGI 3545
            .....|.|......:|.|  :.:..::.:||.||||||..|.||..|:.:..|:.||||||.|.:
  Rat  3421 KIWELQVPCSPRFAIDNF--LTNPTKVRDWNIQGLPSDSFSTENGIIVTRGNRWALMIDPQAQAL 3483

  Fly  3546 KWVKTKYGT-GLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TV 3607
            ||:|...|. ||.::.|...:||..:|.|:..|..:|::|:.|.:||.|||:|.:.:.:.|  .:
  Rat  3484 KWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPSLNPVLNKSVARIGGRML 3548

  Fly  3608 LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEA 3672
            ::|.|:|:::|..||..|.|||:||||.||..|:||::||.|...|||.|||..||:.|||:||.
  Rat  3549 MRIADKEVEYNPNFRFYLTTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEE 3613

  Fly  3673 MRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITG 3737
            .:..|.......|..||.|||::|..|:.|..::|:||.||..|:.:|.||.|:..::..::.|.
  Rat  3614 QKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTE 3678

  Fly  3738 VQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENL 3802
            :.||.|||||||.|:|||:::|:|||:.:|:|:|||||.|:..:|..::.|:..:.||:||:|.|
  Rat  3679 INIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIEYL 3743

  Fly  3803 IDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNF----- 3862
            .|..|:..:.||.|.|||:.||:|...:|.:||...|::...|.:|.||...:.::....     
  Rat  3744 NDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCT 3808

  Fly  3863 TWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIM 3926
            :||....|..|..|:....|.||....|...:.|..:..:.:||....||||:.. :.:||:.|:
  Rat  3809 SWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSNPEKAMLPGEWENACNEMQRMLIV 3873

  Fly  3927 RCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKS 3991
            |.:|.||:::.:.|||...|||::|:...:......|:|:|.:.:.|:|||||||...:.:|.:.
  Rat  3874 RSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKLVMEDSTPRSPLVFILSPGVDPTSALLQLAEH 3938

  Fly  3992 LGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVH 4055
            .|.:   ..||::||||||..:|...:......||||.|.|.||...|:|:|:|.:|. .:.:.|
  Rat  3939 TGMA---HRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPH 4000

  Fly  4056 TSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFK 4120
            .|:||:||:.|..|     .|..||:::||:|.|||.|:.||:.:.....::.....|||.|::|
  Rat  4001 PSFRLWLSSSPHPD-----FPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPTKYK 4060

  Fly  4121 AILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIM 4185
            .:||:||:||:::.||:||...|||..|.||..|..:|..:|..||:.....||:.|:||...:.
  Rat  4061 KLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVN 4125

  Fly  4186 YGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQ----------------GFPAPGILKYTGYH 4234
            ||||:||||||||..||:.::           :|.                ..|..|.|  ..|.
  Rat  4126 YGGHVTDDWDRRLLTTYINDY-----------FCDLSLTTPSYRLSVLDTYYIPKDGSL--ASYK 4177

  Fly  4235 NYIDDNLPS-ESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNII 4298
            .|| ..||| :.|..:|.|.||::....|.:..||..:..|||::|....||:  |:|:.:..:.
  Rat  4178 EYI-SLLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRIGGQ--SREEKVLELA 4239

  Fly  4299 EDILDKTPTPFN------ILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGEL 4357
            .|:..|.|...:      :|.|     |.||..:|..||.:|.|.||..:..||.:|:.|::|.:
  Rat  4240 ADVKQKIPEMIDYEGTRKLLAL-----DPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLI 4299

  Fly  4358 TISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGF 4422
            .:|:.:|::..|::...||..|.|: |||...|.||..||.:|:.:.|.|......|...||:||
  Rat  4300 VMSTSLEEIFNCIFDAHVPPLWGKV-YPSQKPLASWTRDLAVRVEQFETWANRAHPPVLFWLSGF 4363

  Fly  4423 FNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGT 4487
            ..|...|||::|..||:|...:|.:.....|:......|...|::|.::.||::|||.||.|...
  Rat  4364 TFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSC 4428

  Fly  4488 IADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRG-----PTFVWTFNLKSRERAS- 4546
            :.:|...:|...||.::.:.....|:..|.:|.||.|....|.     .:||...:|:|....| 
  Rat  4429 LVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSADRASFVIGIDLRSGAMTSD 4493

  Fly  4547 KWTLAGVCLLL 4557
            .|...|..||:
  Rat  4494 HWIKRGTALLM 4504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 133/616 (22%)
DHC_N2 1368..1770 CDD:285579 141/423 (33%)
P-loop_NTPase 1903..2132 CDD:304359 147/229 (64%)
P-loop_NTPase 2217..2352 CDD:304359 62/142 (44%)
P-loop_NTPase 2510..2783 CDD:304359 102/275 (37%)
P-loop_NTPase 2860..3127 CDD:304359 110/270 (41%)
MT 3140..3480 CDD:289543 109/344 (32%)
AAA_9 3509..3722 CDD:289547 94/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 237/716 (33%)
Dnah2XP_006220764.1 DHC_N1 239..806 CDD:285571 135/624 (22%)
DHC_N2 1304..1709 CDD:285579 141/419 (34%)
P-loop_NTPase 1846..2076 CDD:304359 147/230 (64%)
P-loop_NTPase 2162..2303 CDD:304359 62/141 (44%)
P-loop_NTPase 2462..2728 CDD:304359 102/271 (38%)
P-loop_NTPase 2813..3074 CDD:304359 108/261 (41%)
MT 3087..3419 CDD:289543 109/343 (32%)
AAA_9 3447..3663 CDD:289547 94/216 (44%)
Dynein_heavy 3805..4496 CDD:281078 237/721 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.