DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah5

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_008773325.1 Gene:Dnah5 RGDID:1560828 Length:4548 Species:Rattus norvegicus

Alignment Length:4856 Identity:1359/4857 (28%)
Similarity:2333/4857 (48%) Gaps:633/4857 (13%)


  Fly     1 MADEKE-KKEPVDNRPEFFWNYLTKTMRL-------------KLDKWTKMITTNEFRDVIIEFLN 51
            :.:||| |:..:|.|.::.:..:...:.|             ::::..::......|.::..:.:
  Rat    22 LKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERIDQLFAVGGLRHLMFYYQD 86

  Fly    52 NPNKKRIIFTINSGGQLYPSYSFPVRPRYKV------------AYFIRYLTPLHLTDENM----- 99
            ....:...|  .|.|.:.|:.....:|:..|            .:|.|......:|.||:     
  Rat    87 VEGAEAGQF--GSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFTRADPSKAITAENIHREVS 149

  Fly   100 LNSLLIGDLLPNPLAN-LSILCDEVFFPLLNNTVNQVGWTNVIA-NDMKTESQEMRNGIAQMKGL 162
            .|:|   |.....|.| :..|..::|.|.|.  .:..||..:.. .|..:..||..:.:....|:
  Rat   150 FNTL---DTADGGLLNSVRRLLSDIFIPALR--ASSHGWGELEGLQDASSIQQEFLSSLEGFVGI 209

  Fly   163 V----------INRTIFPLPIC----MDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVE 213
            :          :|     |..|    :..:.:....:|:..    ||.....:|..:..|:..:|
  Rat   210 LSGAQNSLKEKVN-----LQKCDIVELKSLKEPMDYLALAS----NPETVEKVECCMRVWIKQME 265

  Fly   214 DLVNIKAGEKIYSKENFPL--------PEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQ 270
            .::          .||..|        |.|....|:.||.....|.:||....:|.:..:|...:
  Rat   266 QIL----------AENNQLRKEADDVGPRAELEHWKKRLSKFNYLLDQLKSPDVKAVLAMLAAAK 320

  Fly   271 SIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHSR 335
            |.....:|.....|.::..||:|..|.|..|::..|...::|.......|..|:..|.:::..|.
  Rat   321 SKLLKVWRDADIRVTDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMVDAIPTLINAIKMIYSISH 385

  Fly   336 YFHTLNNMTLFFNLFHNSLIDCVNRTVEPD---SIFQGDVDEAYKKLDINMQHLEYYKLIYNECR 397
            |::|...:|..|....|.:|......:..:   :|:....|...:|:...::..:.|:..:.|.:
  Rat   386 YYNTSERITSLFVKVTNQMISACKAHITNNGTATIWSQPQDIVMQKIAAAIKLKQGYQCCFQETK 450

  Fly   398 NSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKGRQIT 462
            ..||:     ..:.:.:.:.:..|||:.:.|..||.::.|:|.|.:.:..|:...:.|       
  Rat   451 QKLKQ-----NPSEKQFDFSEMYIFGKFETFHQRLAKIMDIFTTFKTYSVLQDSKIEG------- 503

  Fly   463 FALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTD----VMERMVSFQFEKGLE 523
              ||.::.:|..:.......:||.:|....:  |.:|...|..:|:    .::|.:...||| ::
  Rat   504 --LEDMVTKYQDVVAGIKKKEYNFLDQRKMD--FDQDYDEFCKQTNELHSELQRFMDTTFEK-IQ 563

  Fly   524 DTHDLLLAGSLLLRPIIKKH---------VEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLN 579
            .|...|        ..:||.         :|....::..:|..:|..:.|.:...|        .
  Rat   564 STRQAL--------STLKKFERLNIPNLGIEAKYQIVFQNFGTDIDMISKLYTKQK--------Y 612

  Fly   580 ELPTDDCFPKVSGAISFLKKLRHRI---IGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDF 641
            :.|.....|.::|.|.:.::|.||:   :.|.::|..    :........|...:|.:.:.:.:|
  Rat   613 DPPLARDQPPIAGKILWARQLFHRLEQPMQLFQQHPF----VLRTVEAKPVIRSYNRIAKVLLEF 673

  Fly   642 TKMLLDKW---TVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNL 703
            ..:....|   ..|...|::..:   |::.....:|.|||..:::...::.:.:..:|..||...
  Rat   674 EVLYHRAWLQQIEEIHVGLEASL---LVKAPGTGQLFVNFDPQILILFRETQCMSQMGLPVSPFA 735

  Fly   704 TKFFCREDELWQ--ARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKW---- 762
            ...|.:.|...:  :.:|:| ::| |.....:..|..::|:...:..::|.::|.|..:.|    
  Rat   736 AALFEKRDMYKKNFSDMKMM-LSE-YQRVKLKMPPAIEQLMLPHLARVDEALQPGLAVLTWTSLN 798

  Fly   763 ------NAFSQRFIVMIFKMVKYLHDRLVAAQE-NLEAIKESIRSWGKVPLFQ------------ 808
                  |||.:      .|.::.|.||:....| .:.||.|.:.|.....|.|            
  Rat   799 IGTYLENAFEK------IKDLELLLDRINDLIEFRIHAILEEMSSVALCQLPQDDPLTCEEFLQM 857

  Fly   809 RKDL--NPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIP-------RRYSLPPG 864
            .|||  |.|..||.   :..|...|.|     .||::|:.|::     :|       |..:..| 
  Rat   858 TKDLCVNGAQKLHF---KSSLVEEAVN-----ELINMLLDVDV-----LPEEASEKVRHENASP- 908

  Fly   865 EHGEEDEESDGIWPPII--------SLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITP 921
             :|:.....:|....:.        ||.:.|..:.||:.||::|..:|..:...|:..       
  Rat   909 -NGDTSGGGEGCAEALASSFNAGTSSLPLTTIARKKKEMEVLEEARELLSYFNHQNTD------- 965

  Fly   922 FHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMEL 986
                .|||.......|:.|  .|:...:|  |..||...|..         .:|:.|||...:.|
  Rat   966 ----ALLKVTRNTLEAIRR--RIHFSHMI--NFRDSKGASKV---------KQNHLPIFRASVTL 1013

  Fly   987 QEPNVVYFRNLDTSSKT-------------GFAFFIETIL----------------DDMNNMMSL 1022
            ..||:.....|:...:|             |...:...:|                :|.::...:
  Rat  1014 AIPNISMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMRERKMAAVQSNEDSDSDTEV 1078

  Fly  1023 LKRVAQDPTEVTNMN------PYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSS 1081
            .:...|:..|:.::|      ..::|..:.|..|:.|....:...|....:.|......|..::.
  Rat  1079 EESELQETLELASVNLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKCYNH 1143

  Fly  1082 LWIWDKS----TYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQ 1142
            :|..:|.    |:::                               :.|.||.::.::..|..|:
  Rat  1144 IWQKEKEDTIMTFIA-------------------------------QNPLLSEFESRILYFQSLE 1177

  Fly  1143 DQIRTWETYEDFFV---FLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANI 1204
            .:|..    |..::   .:.|.....|.::.::...|:.:.......:.::.::.:...|:|  .
  Rat  1178 QEINA----EPEYICVGSIALYTADLKFSLTAETKAWMMVLGRHCNRKYRSEMENIFTVVEE--F 1236

  Fly  1205 VLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPD 1269
            ..|:.....|.:.:...::.|.:|.|:|...|....|::|...||.:|.......|:.:::.|..
  Rat  1237 QKKLNRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRY 1301

  Fly  1270 AWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSK-KFFFVPCLSCYELIDE 1333
            ||.|:...|:..:..:..:|.                  ::||:.:|. :.|...|...|...|.
  Rat  1302 AWEKLLARASDVQNELGALQP------------------SFRKELISTVEVFLQDCQQFYLDYDL 1348

  Fly  1334 SDLELVALEERQRSLAESAVLFELQ-------------GPD---------PVKIELCRFDLKLVK 1376
            :...:..|:.::.|  :..::|:.|             |.:         |..:|: :..|.|::
  Rat  1349 NGPMVSGLKPQEAS--DRLIIFQNQFDNIYRKYITYTGGEELFGLPVTQYPQLLEI-KKQLNLLQ 1410

  Fly  1377 IMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMT 1441
            .::.....:..|:|.::.|.|.:::||.::.|..:|....|.|.:|::.|:.|:.|:.::.:...
  Rat  1411 KIYSLYNNVIETVNSYQDTLWSEVNIEKINSELLEFQNRCRKLPRALKDWQAFLDMKKTIDDFSE 1475

  Fly  1442 SLRAVTELQNPAIRDRHWIELMQTTKVKFSMD---DSTTLKDLIDLNLHEYEEEVKNIVDKSVKE 1503
            ....:..:.:.|:.:|||..:  ||....|:|   ::..|::::::.|.:|:||:::|...:|||
  Rat  1476 CCPLLEYMASNAMVERHWQRI--TTLTGHSLDVGNETFKLRNIMEVPLLKYKEEIEDICISAVKE 1538

  Fly  1504 MAMEKQLRDIATAWG--TMEFGTDIHDRTSIKLL---KASEELIETLEDHQGQLQNMASSKYIAF 1563
            ..:|::|:.:...|.  |:.|.:   .:|..:||   .::.|:|.::||....|.::.|::|...
  Rat  1539 RDIEQKLKQVINEWDNKTLTFSS---FKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMP 1600

  Fly  1564 FEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLA 1628
            |:.:::.|...|||:..||.:|..||..|.|||::|:|. ||..|||::::||..|||.:..::.
  Rat  1601 FKAQIQNWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGG-DIAKQLPKEAKRFSNIDKSWVKIMT 1664

  Fly  1629 QMNADRNVVRST--NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDIL 1691
            :.:...|||:..  :.:..:|..|   ||..|.:|:|:|..|||.|||.:|||:|||...||:||
  Rat  1665 RAHEIPNVVQCCVGDETMGQLLPH---LLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEIL 1726

  Fly  1692 SNGNNPALVARHLTKLYDSMGKL--------NLISGSKNAAGMVAKELEEYVPFLENCDCSGKVE 1748
            ...::...:..||..::|::..:        .::|.|......:  ||::.|.      ..|.||
  Rat  1727 GQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETI--ELDKPVM------AEGNVE 1783

  Fly  1749 VWLNRITDKMRDTLRDQLKRSLTFYDHKPRHV--WIFEWPAQPALVGTQIMWTTETNDAF--AKV 1809
            ||||.:.::.:.:|...::::..........:  ::..:|||..|:|.|::||.::.:|.  ||.
  Rat  1784 VWLNSLLEESQSSLHLVIRQAAANIQESGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALQNAKF 1848

  Fly  1810 QQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTA 1874
            .::   .::..|:..:..||.||.:...||::.||.|..|:.||.||.||:...:....|:..|.
  Rat  1849 DKK---IMQKTNQSFLELLNMLIEMTTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTD 1910

  Fly  1875 FQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAP 1939
            |:|..|.|..:....|....:|.|..|.|..|:||.|.|||||||||||||||.|:|.:.|||||
  Rat  1911 FEWLKQCRFYFKEDSDKTMIHITDVAFTYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAP 1975

  Fly  1940 AGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLS 2004
            ||||||||||||||:||.||..|.|||||:|||::.:|.|.|||||:|:||||||||||.:.|||
  Rat  1976 AGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLS 2040

  Fly  2005 VVAVQVKCIQDAIKSKKQTFSFL-GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVV 2068
            |.|.|:..|....|..|::|.|. |:::.:....|:|:|||||||||.|||||||..:|..||:|
  Rat  2041 VAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMV 2105

  Fly  2069 PDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDR 2133
            ||..:|..:.|.:.||.:..:|||||.|||.||:|.||||                         
  Rat  2106 PDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQ------------------------- 2145

  Fly  2134 QRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPE 2198
                                       :.|.:  :|...:.....:|.::               
  Rat  2146 ---------------------------YGGFV--VFQVEEAGLINHPPWK--------------- 2166

  Fly  2199 DGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYN-DLNPKAVTNDELF 2262
                ||::||.|...|||.:..:|.:|:||:....||.|. .....|||.. .:||||:|..::|
  Rat  2167 ----LKVIQLFETQRVRHGMMTLGPSGSGKTSCIHTLMKA-MTDCGKPHREMRMNPKAITAPQMF 2226

  Fly  2263 GIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI 2327
            |.::.:|.:|.||:||.|.|...........||||||.:|.:|||:||:|:||||.||||:.:||
  Rat  2227 GRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRI 2291

  Fly  2328 ALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKY 2392
            .:....:::||..::..|:||||||.|:::::...|.|:|.::.:| .|.:..|..:|..|:.:.
  Rat  2292 PMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFL-KRRSPQEAEILRQLYAET 2355

  Fly  2393 VPPLLDIFRTRLRSI---TPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFG 2454
            .|   |::|..::::   ..|.:...:..:.::|..::..:....|...:.....|||.::|..|
  Rat  2356 FP---DLYRFSIQNLEFKMEILEAFVITQSTHMLQGLIPTKEQAGDVDPEHLGRLFVFAMMWSVG 2417

  Fly  2455 SSLFQDQIIDWSNEFSKWFLN-EYKAVKFPL----SGTIFSFYIDHETKKFFPWTNLVPQFELDM 2514
            :.|    .::.......|..: |...:..|.    ..|:|.:|:..: ..:..|:..:|::....
  Rat  2418 AVL----ELEGRRRMELWLRSREGPTLHLPQLTDPGDTMFDYYVAPD-GTWRHWSMCIPEYVYPP 2477

  Fly  2515 DLPLQ--SNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVP 2577
            |...:  |.||...:..|..|.:.|:.:....::|||..|:.||:::...:|....:.::|.|:.
  Rat  2478 DTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHTVKNLN 2542

  Fly  2578 FNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYH 2642
            |:..||..|.||.:|..::|:.|..|||...|:|..|:||:|||.::::.....:.::||.|:.:
  Rat  2543 FSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQN 2607

  Fly  2643 HWYDRQK----MTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPP---SQDALFHILNS 2700
            .:|:.:|    .::.||.  .:.|.::|..|...|..||:|.|..|....|   |.|.:|.::..
  Rat  2608 GFYNLEKPGEFTSIVDIQ--FLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGE 2670

  Fly  2701 ---ILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGV 2762
               ...:.....:|   .|||||..  :|..:....|:  ..|||..||||.|||||::.|:.|:
  Rat  2671 GYYCAQRGFSKEVQ---DAVIKLVP--LTRRLWQMTKL--KMLPTPAKFHYVFNLRDLSRIWQGM 2728

  Fly  2763 LYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRK--GIEGVNDDVVYAQP 2825
            |...||...::::::|||.|||.||..|:....:|:..|.|.|..:|.:  |.|        ..|
  Rat  2729 LNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE--------KTP 2785

  Fly  2826 LIYC----HFAKGLTDIK-----------------YMPISGWDRLKSLLDEAQDRYNDYI--GAM 2867
            ::.|    :|...|.|..                 |.||:..:.|:..|......||:.|  ..|
  Rat  2786 VVDCGVDAYFVDFLRDAPEATGETPEETDAEMPKLYEPIASLNHLQERLSVFLQLYNESIRGTGM 2850

  Fly  2868 NLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDL 2932
            ::|.|.|||.|:.:|||::.:.||.|||:|||||||||||||||||:....|||.||:.|:.|:|
  Rat  2851 DMVFFRDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNL 2915

  Fly  2933 KANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEV 2997
            ..::..||..||.:.....|:.||:|:..|.||..:|::|:||::..||..||::.|.:.:.:.:
  Rat  2916 MEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTSIM 2980

  Fly  2998 KQLGIVDN------RENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEW 3056
            |:    ::      .:|.::||:.:||..|.:||||||||...|.|:.|||||::..|||||..|
  Rat  2981 KK----EHPKRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRW 3041

  Fly  3057 PQQALESVSLRFLSEITV-----LPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSF 3116
            |:.||.:||..|||...:     :.|||...:.:|...|.:...|    |....:|..:.||||:
  Rat  3042 PKDALVAVSEHFLSSYNIDCTAEIKKELVQCMGSFQDGVAEKCAD----YFQRFRRSTHVTPKSY 3102

  Fly  3117 LELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLII 3181
            |..|..|..:..||.........|:..||.||...::.|.||...|.|:|.||::.|::||.::.
  Rat  3103 LSFIQGYKFIYEEKHVEVQSLANRMNTGLEKLKEASESVAALSQELAVKEKELQVANEKADMVLK 3167

  Fly  3182 VVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTE 3246
            .|..:.:...|.:|...|.:...:.|.:.::....:.||....|:|||..|:.||.|:..:::..
  Rat  3168 EVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIAT 3232

  Fly  3247 LKSFGSPPDAVVSVCGAVLVLFSSK---GKIPKDR-----SWKACRAFM--GNVDKFLDNLINYD 3301
            :::.|.||..::.:...||:||..:   .||..|:     ||:.....|  ||   ||.||..:.
  Rat  3233 VRTLGRPPHLIMRIMDCVLLLFHRRVNAVKIDLDKSCTVPSWQESLKLMTAGN---FLQNLQQFP 3294

  Fly  3302 KKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEK 3366
            |..|:.:||:.|.||...::::.|.........||||||...:..|:.:...|.|.:..|:..|.
  Rat  3295 KDTINEEVIEFLSPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQEN 3359

  Fly  3367 EVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEK 3431
            ....|...|......|.:.:.:|:.:|.||::|:.:||...::|.:....:..|:.||.|||.||
  Rat  3360 RHALAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDADRCRHKMQTASTLISGLAGEK 3424

  Fly  3432 IRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVD 3496
            .||.|..|.....|::|.||:|:.:.|:||.|.|.:.:|..|... |....|..:  ||..:.::
  Rat  3425 ERWTEQSKEFAAQIKRLVGDVLLATAFLSYSGPFNQEFRDLLLND-WKKEMKARK--IPFGNDLN 3486

  Fly  3497 PFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTG-LVVLR 3560
            ..||:.|...|:|||.||||:|.:|.:|..|:.::.|.||:||||.||..|::.|.... |.:..
  Rat  3487 LNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRSPLLIDPQTQGKIWIRNKESQNELQITS 3551

  Fly  3561 LSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRL 3623
            |:.:.:.:.:|.::|.|..||||::||.:||.|:.:|.:..||.|:.  :|:||:|:|....|:|
  Rat  3552 LNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKL 3616

  Fly  3624 ILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITL 3688
            .:.|||.||.|.||:.|:|.:|:||||..|||||||..|:..|:.:||..||.|.::....|...
  Rat  3617 YITTKLPNPAYTPEISARTAIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEEVTANKRRT 3681

  Fly  3689 KFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAER 3753
            |.|||:||.||:|...:::||.:|::.|..|||||:|:..|:..:..|.:||:||||.|||.|.|
  Rat  3682 KELEDNLLYRLTSTQGSLVEDESLIVVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATR 3746

  Fly  3754 ASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGL 3818
            .||:||::.::..:|.:||.||:.|..:|:.::.:::.:.....|:.|:|:.:|:..|.|..:||
  Rat  3747 GSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIGNIIEHMTYEVFKYAVQGL 3811

  Fly  3819 FEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR---------FPYMPNQTSNFTWLTHVGWGGIR 3874
            :|:.|.:|...|.::|.:....|:..|...|::         .|:.|::     |:..:.|..:.
  Rat  3812 YEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPHKPSK-----WILDMTWLNLV 3871

  Fly  3875 ALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEW-KGKSAIQRLCIMRCIRPDRMSYAM 3938
            .|:....|..:...|..:.|.|:.:.|.|:||.|..|..: |.....:||.::|...|||.....
  Rat  3872 ELSKLKQFSDILDQISRNEKLWRIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQA 3936

  Fly  3939 RSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHS 4003
            |.:|.:.:|..|.:...::..:|:|||.|.|.:..:||.|.||...:..|||.|.....:     
  Rat  3937 RKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRY----- 3996

  Fly  4004 VSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKME--SSLSNVHTSYRLFLSAEP 4066
            ||:|||||:.|...:......|.||:|||.||   .|..|::.|:  :....||.::||:::.| 
  Rat  3997 VSMGQGQEVHARKLLHQTMANGGWVLLQNCHL---GLDFLDELMDVVTETETVHDTFRLWITTE- 4057

  Fly  4067 AGDPAAH-ILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFH 4130
                 .| ..|..:|:.:||..||||.|:.|.:.:.....|.:.|:: |...::|.:|:::.:.|
  Rat  4058 -----VHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDV-SVGAQWKPMLYAVAFLH 4116

  Fly  4131 AVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL---EANTRVPWEDLRYLFGEIMYGGHITD 4192
            :.|.|||||||.|||..|.||..|...:|..:.|:|   :....|.|..:||:.|||.|||.:||
  Rat  4117 STVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTD 4181

  Fly  4193 DWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPS-ESPSLYGLHSNAE 4256
            |:|:||..|:.:.:....:...:..:.||:..|......||..|| .:||: :||.::|||.||:
  Rat  4182 DYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYI-QSLPAYDSPEVFGLHPNAD 4245

  Fly  4257 IGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTP---TPFNILELMGRV 4318
            |.:.:.:::.:...:..:||:   .||||...::|.::..:.:|:|:|.|   :||.:.|.:.::
  Rat  4246 ITYQSKLAKDVLDTILGIQPK---DSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKM 4307

  Fly  4319 EDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLA 4383
            ....|..|...||.:||..:::.::.:|.||.|.:.|.:.:|..:.|.:.|::..::|.:|.|.:
  Rat  4308 GPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSDNLRDALDCMFDARIPARWKKAS 4372

  Fly  4384 Y-PSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNE-WPLDR 4446
            : .|.||.  ||::|:.|..:...||::.| |...|:.||||||..|||:.|:..|.|: |.||.
  Rat  4373 WVSSTLGF--WFTELLERNCQFTSWVSNGR-PHCFWMTGFFNPQGFLTAMRQEITRANKGWALDN 4434

  Fly  4447 MCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQD 4511
            |.|..:|||..|::::..|.||.|:.||::|||.||.:...:.::..|.||..|||:.|.|....
  Rat  4435 MVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFAENNT 4499

  Fly  4512 KQDIKNVYECPVYKIRLRGP-TFVWTFNLKSRERASKWTLAGVCLL 4556
            .:| ..:|.||:||..:|.. .::...:||:.:....|.|.||.||
  Rat  4500 ARD-PRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWILRGVALL 4544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 113/608 (19%)
DHC_N2 1368..1770 CDD:285579 117/420 (28%)
P-loop_NTPase 1903..2132 CDD:304359 127/230 (55%)
P-loop_NTPase 2217..2352 CDD:304359 56/136 (41%)
P-loop_NTPase 2510..2783 CDD:304359 85/285 (30%)
P-loop_NTPase 2860..3127 CDD:304359 114/280 (41%)
MT 3140..3480 CDD:289543 105/350 (30%)
AAA_9 3509..3722 CDD:289547 93/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 225/699 (32%)
Dnah5XP_008773325.1 DHC_N1 248..802 CDD:285571 113/606 (19%)
DHC_N2 1402..1804 CDD:285579 117/420 (28%)
P-loop_NTPase 1939..2171 CDD:304359 132/305 (43%)
P-loop_NTPase 2181..2316 CDD:304359 56/136 (41%)
P-loop_NTPase 2485..2749 CDD:304359 84/273 (31%)
P-loop_NTPase 2841..3110 CDD:304359 114/277 (41%)
MT 3126..3470 CDD:289543 104/348 (30%)
AAA_9 3499..3715 CDD:289547 93/216 (43%)
Dynein_heavy 3857..4537 CDD:281078 226/708 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.