DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah17

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017459689.1 Gene:Dnah17 RGDID:1563805 Length:4462 Species:Rattus norvegicus

Alignment Length:4588 Identity:2373/4589 (52%)
Similarity:3152/4589 (69%) Gaps:170/4589 (4%)


  Fly    12 DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPV 76
            |.|.::.....:..::.|.|||:|::...|...:..||.:......::.|:|..|.:.|...||.
  Rat     3 DPRIDYLETVSSALLKFKPDKWSKLVGAEENMALFTEFFDKTENPVLVMTLNPAGIIIPCLGFPE 67

  Fly    77 RPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVI 141
            ..:.|..|||| ..|.::|.:|....|:.||:.|.|:..|..:.:||.:.|||...|..||..|:
  Rat    68 SLKTKGVYFIR-TKPENITKDNYKTRLIYGDISPTPVDQLIAVVEEVLYSLLNQNENMDGWPRVV 131

  Fly   142 ANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMD------EVMQAAPAIAMGDISVVNPLMKHS 200
            :.|:..:...::|.:..|.|.:..:|:.|:|..:.      |.|:..|:      |:.|.|: ||
  Rat   132 SEDIVKQVHRLKNEMFVMGGKIKGKTLLPIPEHLGSLDGTLESMERIPS------SLDNSLL-HS 189

  Fly   201 LEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFV 265
            :|.:::.|...:.|:::..:.:.:....: |||...|.||::||.||:.:.|||...::..|..:
  Rat   190 IETIIIDWSHQIRDVLSKDSAQALLDGLH-PLPRVEFEFWDARLMNLQCIHEQLNRPKVNKIVEI 253

  Fly   266 LEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLV 330
            |||.:|.:..:.:.:...|.:.|.||.||...|.||:..:::.|..|.....|.|..::.||..:
  Rat   254 LEKAKSCYWPALQNVYMNVTQGLKEANDIVLYLKPLRILLEEMEQADFTVLPSFIVKVLSTICFI 318

  Fly   331 WGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSI---FQGDVDEAYKKLDINMQHLEYYKLI 392
            |..|.:::|.:.:.:....|.|.:|:.....:.|:.:   .||:::|....:..::..|:.....
  Rat   319 WATSEHYNTPSRVIVILREFSNQIIEMTRTYLSPEEVLKGLQGEIEEVLGGISQSVGVLKELFHA 383

  Fly   393 YNECRNSLKKFKIGTTFNSQ---DWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMG 454
            |:.|..::|.|     |..:   .|.:.....|.|::.|..|::.::||:.|..:|.|||||.:|
  Rat   384 YDFCCANMKLF-----FKDRPPVPWEFPSSLAFSRMNAFFHRVQTIEDLYKTAIEFLKLEKIELG 443

  Fly   455 GLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFE 519
            |::|..:...:.:|.:|...:.:.:...:|:|:||.  :|.|..|...|:.|...::|.::..|.
  Rat   444 GVRGNILGNLVTQIYDEVFELVKVFAECKYDPLDPG--DSSFDDDYNDFETKIQDLDRRLATIFC 506

  Fly   520 KGLEDTHD-------LLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTA-L 576
            :..:|.:.       |.:.|.||.||:|...|.|...|:::.|..|:       .|.|.::.| :
  Rat   507 QAFDDCNCIESSAKLLYMCGGLLERPLILVEVVPRYSVMLEMFNTEL-------DNAKLMYDAQM 564

  Fly   577 GLNE----LPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQE 637
            ..:|    .|.....|.|:|.:.:..:|:.|:....|..:..::|:..:.....|.|.::.|:..
  Rat   565 AASEDGQIPPIHKNMPPVAGQLKWSLELQERLEVSMKYLKHIDHPVMSSVEAKLVYDKYDEMIGL 629

  Fly   638 IDDFTKMLLDKWTVECWQGIQQD----ITLTLIEKDEANEL-RVNFTERLIFALKDIKVVRL-LG 696
            :..:.:....:|.    :|:.||    :...||::|..:.| :|||::.|:..|:::|.:.. ..
  Rat   630 LKGYREKKYQQWV----EGVDQDCHFNLGQPLIQRDPFSSLIQVNFSKALVAVLREVKYLNFQQQ 690

  Fly   697 CDVSVNLTKFFCREDELWQARV-KLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFI 760
            .::..:..|.| .|:|:::..| .|..|..|||:........|..||.:|:..|:.::......:
  Rat   691 KEIPSSAEKLF-SENEIFRKFVGNLELIVGWYNEIKTTVMEVEFPLIKSELEEIDVKLMSAETTL 754

  Fly   761 KWNAFSQRFIVMIFKMVKYLH---DRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDP 822
            .||  .:..:..|.:|.:.||   :|:...::|:|.|.::::.|...|||:|||.....||..|.
  Rat   755 FWN--GENVMEYIQEMREILHNLQNRIQKTKQNIEGITQAMQEWSANPLFERKDNKKEALLDLDG 817

  Fly   823 REPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMT 887
            |...|:.|.|...|....|..::..|.:||                   ::|             
  Rat   818 RVANLNKRYAAVKDAGVRIQAMVTENAELF-------------------KAD------------- 850

  Fly   888 SVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAE 952
                                                       .:.:       |..|:|.::.:
  Rat   851 -------------------------------------------TTSQXXXXXXXYVNYIDAMVLD 872

  Fly   953 NLVDSVITSSTYL--RMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDD 1015
            .....:..|..||  .|.:|   ||..|:|||.|||.|..:.:...|:...:..|...||.:::|
  Rat   873 EFDRFIRKSLNYLMDNMTMD---ENIAPLFEIRMELDEDGLTFNPTLEMGDEDSFLSLIEGLIND 934

  Fly  1016 MNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFS 1080
            :.|:..|:.|:|:        ...::..:|:|.::|.:.|.|:.:.:..|::....:...|..:|
  Rat   935 LYNVARLIPRLAK--------GRINYKSDLEDITDLIEMREELSSLVIGAMKVAEEYQDSFERYS 991

  Fly  1081 SLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQI 1145
            .||:.|...::.....||...|.:|.|.:.|       ..:....|.|:.:::|:|.:.:|.:::
  Rat   992 YLWVDDLQEFMKNFLIFGHAPTPEELDTKID-------DTIPKTQPTLAQFQQQIDSYEKLYEEV 1049

  Fly  1146 RTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIEL 1210
            ...|..:.|..:|:.:...||.|:|:.:.:|..|||..|.:.|.|||.:|:.|:......||..|
  Rat  1050 SRCENTKVFHGWLQCDCRPFKQALLNTIKRWSLLFKRYLSDHVINSLADLESFMGVTRTGLKKPL 1114

  Fly  1211 QKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVK 1275
            ::.|::|||:::..|.::.|:|...||||:|||:.|:||:.|..|..:....::.|||:.|...|
  Rat  1115 KEGDYDGLVEVMGHLMKVKERQVATDSMFEPLKQTIELLKSYGEEMPEETYLKLQELPEQWTNTK 1179

  Fly  1276 RLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVA 1340
            :||...||.:||:|:.:|:::.::....:...:.:|:||.....|.......|:.:::....:.|
  Rat  1180 KLAIQVKQNVAPLQANEVNILRRKCQQFELKQHEFREKFRRDAPFTFSDPDPYKSLNKQQKSISA 1244

  Fly  1341 LEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENM 1405
            :|....:|.:|..|||:..||..:::.|..:::|:|.:||..:.:.::|:|||.|.||.|::|.|
  Rat  1245 MEGVMEALCKSGSLFEVTVPDYKQLKACHKEVRLLKELWDMIVMVNTSIDDWKTTKWKDINVEQM 1309

  Fly  1406 DQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKF 1470
            |.:||||.:::|.|||.|:.|:.|:.::.::||::||||||:||||||||:|||.:|||.|:|||
  Rat  1310 DIDCKKFAKDVRSLDKEMKAWDAFVGLDNTVKNMITSLRAVSELQNPAIRERHWQQLMQATQVKF 1374

  Fly  1471 SMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLL 1535
            .|.:.|||.||:.||||:||:||:|||||:|||..|||.|:.:.:.|.||||..::|.||...||
  Rat  1375 EMSEETTLADLLQLNLHKYEDEVRNIVDKAVKESGMEKVLKTLDSTWSTMEFEHELHPRTGTMLL 1439

  Fly  1536 KASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFI 1600
            |:.|.|:|||||:|.||||:..|||::.|..||..||.:||.||.:|..||||||.|.:||||||
  Rat  1440 KSDELLVETLEDNQVQLQNLMMSKYLSHFLKEVTSWQQKLSTADSVISIWFEVQRTWSHLESIFI 1504

  Fly  1601 GSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKAL 1665
            ||||||:||||||||||.||:|||||:.......|||.:||:.|  ||:.||.|.|.|.:|||||
  Rat  1505 GSEDIRAQLPEDSRRFDSIDQEFKALMEDAVKTPNVVEATNKPG--LYDKLERLKKSLAVCEKAL 1567

  Fly  1666 NDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL---ISGS--KNAAG 1725
            .:|||||||::|||||||||||||||||||:|..|:|||:||:||:.||..   .||:  |...|
  Rat  1568 AEYLETKRLAFPRFYFVSSADLLDILSNGNDPVEVSRHLSKLFDSLCKLKFRLDASGNPIKVGLG 1632

  Fly  1726 MVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPA 1790
            |.:|| :||:.|.:.||.||:|||||||:.|:|..|||.::..::..|:.|||..|||::|||.|
  Rat  1633 MYSKE-DEYMDFDKECDLSGQVEVWLNRVLDRMCATLRHEIPEAVVTYEEKPREQWIFDYPAQVA 1696

  Fly  1791 LVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDV 1855
            |..|||.||||...|||::::.||||:||||||||:|||.||.||:|:|:|.:|.||||||||||
  Rat  1697 LTCTQIWWTTEVGLAFARLEEGYENAIKDYNKKQISQLNALITLLIGNLSAGDRMKIMTICTIDV 1761

  Fly  1856 HSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLT 1920
            |:||||..:|..|||...||.||||||||||.:...|||||||||.:|.||||||||||||||||
  Rat  1762 HARDVVAKMITAKVESSQAFTWQSQLRHRWDEEKKHCFANICDAQIQYSYEYLGNTPRLVITPLT 1826

  Fly  1921 DRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQ 1985
            |||||||||||||:|||||||||||||||||||||||||.|||||||||||||||.|:|:|||||
  Rat  1827 DRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGTMVYVFNCSEQMDYKSCGNIYKGLAQ 1891

  Fly  1986 TGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGR 2050
            ||||||||||||||||||||:||||||:||||::||:.|:||||.|:|..|||:|||||||||||
  Rat  1892 TGAWGCFDEFNRISVEVLSVIAVQVKCVQDAIRAKKKKFNFLGEMISLIPTVGIFITMNPGYAGR 1956

  Fly  2051 AELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGL 2115
            .|||||||||:||||||||||.||.|||||||||.||||||||||||||||||||||||||||||
  Rat  1957 TELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARLLARKFITLYTLCKELLSKQDHYDWGL 2021

  Fly  2116 RAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNP 2180
            |||||||||||:|:|.|..|.|||||||||||||||||||||:||||||||||||||||||||:.
  Rat  2022 RAIKSVLVVAGSLKRGDPTRAEDQVLMRALRDFNIPKIVTDDLPVFMGLIGDLFPALDVPRKRDL 2086

  Fly  2181 EFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRK 2245
            .||.:||:|.::||||.||.|:||:||||||..||||||:||.||:|||:|.|:|||||||.|||
  Rat  2087 NFEKIIKQSIVELKLQAEDSFVLKVVQLEELLQVRHSVFVIGNAGSGKSQVLKSLNKTYQNMKRK 2151

  Fly  2246 PHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLN 2310
            |...||:|||||.||||||:||:||||||||||.:|||.||:...||||||||||||||||||||
  Rat  2152 PVAVDLDPKAVTCDELFGIINPATREWKDGLFSTIMRDLANITHDGPKWIVLDGDIDPMWIESLN 2216

  Fly  2311 TVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGT 2375
            |||||||||||||||||.|.:.|||:|||:.|||||||||||||||||||.||||.|.:.||:..
  Rat  2217 TVMDDNKVLTLASNERIPLNRTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPVVSSWIER 2281

  Fly  2376 RTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDW 2440
            |...||.:.|.:|||||:|..||..|...:.|||:.:|..:|...|||:.:||.:|.|.|.||:.
  Rat  2282 RKVQSEKANLIILFDKYLPTCLDKLRFGFKRITPVPEITVIQTILYLLECLLTEKNAPPDSPKEL 2346

  Fly  2441 YEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTN 2505
            ||:||||...|.||.::||||:||:..|||||::||:|.:|.|..||||.:|||.|||||.|||:
  Rat  2347 YELYFVFACFWAFGGAMFQDQLIDYRVEFSKWWINEFKTIKLPSQGTIFDYYIDPETKKFLPWTD 2411

  Fly  2506 LVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDK 2570
            .||.||||.|:|||::||:|.||.|:|:|||.|:....|:||:|.:|:||::||..||..|.:|.
  Rat  2412 KVPNFELDPDIPLQASLVHTTETIRIRYFMDLLMAKAWPVMLVGNAGTGKSVLMGDKLENLSTDD 2476

  Fly  2571 YSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLI 2635
            |.|..|||||||||.|||.:||||||||:||||||.|.|::|||:|||||||||||.||.|||||
  Rat  2477 YLVQAVPFNFYTTSAMLQGVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDKYGTVAPHTLI 2541

  Fly  2636 RQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNS 2700
            ||.||:.|||||||:||:|:|.|..||||||::||||||||||||||.|||:.|..:||..|.|:
  Rat  2542 RQHMDHRHWYDRQKLTLKDVHNCQYVACMNPTSGSFTIDPRLQRHFCVFAVSFPGHEALITIYNT 2606

  Fly  2701 ILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYS 2765
            ||:||:.  .:.....:.:||.::||.|:.||.||.::||||||||||.|||||::|||.|:|:|
  Rat  2607 ILAQHLS--YRSAPSVIQRLCSHLVTAALALHQKVAATFLPTAIKFHYIFNLRDLSNIFQGILFS 2669

  Fly  2766 NSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCH 2830
            ..|.......::|||:||..||||||:||..|..:.:::.....:|..:.:.::.::|:|.|:||
  Rat  2670 TLEILRTPLDIVRLWLHEAERVYGDKMVDEKDQETLRRVTMASTKKFFDDLGEEHLFAKPNIFCH 2734

  Fly  2831 FAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALL 2895
            |.:|:.|.||.|::....|..||.:..|.||:....||||||:||::|:|||:|||||.||.|||
  Rat  2735 FTQGIGDPKYFPVTDVAHLNKLLKDVLDSYNEVNAVMNLVLFEDAVAHICRINRILESPRGNALL 2799

  Fly  2896 IGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVA 2960
            :||||||||||:|||::||:||||||.|.|.|::.|||.::|..|:|:.||.....||||||:||
  Rat  2800 VGVGGSGKQSLSRLAAYISALDVFQITLKKGYAIPDLKMDLAAQYIKSAVKNVPSVFLMTDSQVA 2864

  Fly  2961 REQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVL 3025
            .||||||:|||||||:|..||.||::|||::::|.:||.||:.|.||.|||:||||||..|||:|
  Rat  2865 EEQFLVLINDLLASGEIPGLFGDDDLENIISSMRPQVKSLGMTDTREACWKFFIEKVRKQLKVIL 2929

  Fly  3026 CFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFV 3090
            ||||||:.||||:|||||:||||.||||||||:.||.|||.|||.|...:..|:...:|.||::|
  Rat  2930 CFSPVGSVLRVRARKFPAVVNCTAIDWFHEWPEDALVSVSARFLQETQGIQPEVKTSISLFMSYV 2994

  Fly  3091 HKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEV 3155
            |.|||::||.|||..:||||||||:|||.|.||..||.:|....:.:..||||||:||.|...:|
  Rat  2995 HTTVNEMSKTYLATERRYNYTTPKTFLEQIKLYQNLLAKKRMELVAKIERLENGLMKLQSTASQV 3059

  Fly  3156 DALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEE 3220
            |.|:..|.|||.|||.||:.||.||.|||.|.||||||:|.|.:||..|..|.::||.|.|.||.
  Rat  3060 DDLKAKLAVQEAELKQKNENADKLIQVVGVETEKVSKEKAIADEEEIKVEVINKNVTEKQKACET 3124

  Fly  3221 DFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRA 3285
            |..||:|||:||||||:|||||||||||||||||||||:|..||::|.:..||||||:||||.:.
  Rat  3125 DLAKAEPALLAAQEALDTLNKNNLTELKSFGSPPDAVVNVTAAVMILTAPGGKIPKDKSWKAAKI 3189

  Fly  3286 FMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDV 3350
            .||.||.|||:|..:||:||....:||.:||..:..|.||.|.:||:||||||||.|||.|||:|
  Rat  3190 MMGKVDTFLDSLKRFDKEHIPEACLKAFKPYQGNPTFDPEFIRSKSTAAAGLCSWCINIVRFYEV 3254

  Fly  3351 YLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAF 3415
            |..|.||.:||.|:..|:.:|:|||:.:..::.||...||.|...:::|.|:|.|||.||..|..
  Rat  3255 YCDVAPKRQALEEANAELAEAQDKLSRIKNKIAELNANLNNLTSAFEKATAEKIKCQQEADATNR 3319

  Fly  3416 TIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMP 3480
            .|.:||||:||||:|.:||.|||:........|.||:|:||.|:||||.||:.||.||.||.|:|
  Rat  3320 VISLANRLVGGLASENVRWAESVENFRSQGVTLCGDVLLISAFVSYVGYFTKKYRNELMEKFWIP 3384

  Fly  3481 AFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGI 3545
            ...|.:.|||.|:|:||..::.|||.:|.||||||||||||.|||.||..:||:||::|.|||||
  Rat  3385 YVNNLKVPIPITEGLDPLTLLTDDADVATWNNQGLPSDRMSTENATILCNTERWPLIVDAQLQGI 3449

  Fly  3546 KWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKI 3610
            ||:|.|||:.|..:||.|::|||.:|:|:|.|..||||||||.:||||:|||||..||||..:||
  Rat  3450 KWIKNKYGSELKAIRLGQKSYLDIIEQAISEGDTLLIENIGETVDPVLDPLLGRNTIKKGRFIKI 3514

  Fly  3611 GDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRT 3675
            ||:|::::..||||||||..|||||||||||.|||||.||||||||||||.||..||||||.::.
  Rat  3515 GDKEVEYHPSFRLILHTKYFNPHYKPEMQAQCTLINFLVTRDGLEDQLLAAVVAKERPDLEQLKA 3579

  Fly  3676 RLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQI 3740
            .||:.||.|||.||.|||.||||||:|..|.|.|..||.|||.||.||:|||.||.|||||..:|
  Rat  3580 NLTKSQNEFKIVLKELEDSLLARLSAASGNFLGDTALVENLETTKHTANEIEEKVQEAKITETKI 3644

  Fly  3741 DSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDS 3805
            :.|||.|||||.|||::|||||||.|||||||||||||.|||..|:.|...||:::.||.||.|.
  Rat  3645 NEARENYRPAAARASLLYFILNDLNKINPIYQFSLKAFNVVFEKAIQKTPPAEEVRQRVINLTDE 3709

  Fly  3806 ITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGW 3870
            ||:..::||:|||||:||||||.|:..|:|....|:.|.|||||||||:.....|...:|.|..|
  Rat  3710 ITYSVYMYTARGLFERDKLIFLAQVTFQVLSMKKELNPVELDFLLRFPFKAGVVSPVDFLQHQSW 3774

  Fly  3871 GGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMS 3935
            |||:||:....||.|:.|||||.|||||.|:||:||.|.||.|||.|:|:|:||::||:|||||:
  Rat  3775 GGIKALSEMDEFKNLDSDIEGSAKRWKKLVESEAPEKEIFPKEWKNKTALQKLCMVRCMRPDRMT 3839

  Fly  3936 YAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHEN 4000
            ||:::|:|||:|||:::.||:|||:::|||||.|.|||:||||||||||||.|||.|||:.|:..
  Rat  3840 YAVKNFVEEKMGSKFVEGRSVEFSKSYEESSPSTPIFFILSPGVDPLKDVEALGKKLGFTIDNGK 3904

  Fly  4001 FHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAE 4065
            .|:||||||||:|||:|:::|::.||||||||||||||||..|:||:|...|..|..||:|:|||
  Rat  3905 LHNVSLGQGQEVVAEDALDVAAEKGHWVILQNIHLVARWLSILDKKVERYSSGSHEDYRVFISAE 3969

  Fly  4066 PAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFH 4130
            ||.....||:||||||:||||||||||||.||:|||||.|:.:|||||:||.|||.|||:|||||
  Rat  3970 PAPSVETHIIPQGILENAIKITNEPPTGMYANLHKALDLFTQDTLEMCTKEIEFKCILFALCYFH 4034

  Fly  4131 AVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWD 4195
            ||||||||||.||||||||||.||||||:.|||||||||.:|||:||||||||||||||||||||
  Rat  4035 AVVAERRKFGAQGWNRSYPFNNGDLTISINVLYNYLEANPKVPWDDLRYLFGEIMYGGHITDDWD 4099

  Fly  4196 RRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFL 4260
            ||||||||.||::.|:::||:....||..|..|.|.|||.|||:|||.|||.|||||.|||||||
  Rat  4100 RRLCRTYLIEFIRVEMLEGEVLLAPGFQIPPNLDYKGYHEYIDENLPPESPYLYGLHPNAEIGFL 4164

  Fly  4261 TTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYI 4325
            |..||:|||.|.|:||:.| .|..|..||:|:.:|.:::|||:|.|..||:.|:|.:..:::||:
  Rat  4165 TVTSEKLFRTVLEMQPKET-DSGAGTGVSREEKVKAVLDDILEKIPETFNMAEIMAKAAEKTPYV 4228

  Fly  4326 IVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGL 4390
            :||||||||||.|..|::|||.||:|||||||||::.||||...|:.|.|||.|...|||||:||
  Rat  4229 VVAFQECERMNILTNEMRRSLKELNLGLKGELTITTDMEDLSTALFYDTVPETWVARAYPSMMGL 4293

  Fly  4391 QSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTK 4455
            .:|:|||:.|:||||.|..||.:|:::||||||||||.||||||..|||||||||:|||:.:|||
  Rat  4294 AAWYSDLLQRIRELESWTTDFALPTTVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMCLSVEVTK 4358

  Fly  4456 KWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYE 4520
            |.:|::|..||||:|:.||||||||||.:.|.||:|.||:|.|.|||::|||:..|:.:.||:||
  Rat  4359 KTREDMTAPPREGSYVYGLFMEGARWDTQTGVIAEAKLKDLTPVMPVIFIKAIPVDRMETKNIYE 4423

  Fly  4521 CPVYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLLQ 4558
            |||||.|:||||:|||||||::|:|:||.||.|.||||
  Rat  4424 CPVYKTRIRGPTYVWTFNLKTKEKAAKWILAAVALLLQ 4461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 142/591 (24%)
DHC_N2 1368..1770 CDD:285579 232/407 (57%)
P-loop_NTPase 1903..2132 CDD:304359 203/229 (89%)
P-loop_NTPase 2217..2352 CDD:304359 107/135 (79%)
P-loop_NTPase 2510..2783 CDD:304359 166/273 (61%)
P-loop_NTPase 2860..3127 CDD:304359 171/267 (64%)
MT 3140..3480 CDD:289543 192/340 (56%)
AAA_9 3509..3722 CDD:289547 143/213 (67%)
Dynein_heavy 3864..4549 CDD:281078 449/685 (66%)
Dnah17XP_017459689.1 DHC_N1 185..764 CDD:285571 144/602 (24%)
DHC_N2 1272..1676 CDD:285579 232/407 (57%)
P-loop_NTPase 1809..2039 CDD:304359 204/230 (89%)
P-loop_NTPase 2123..2258 CDD:304359 107/135 (79%)
P-loop_NTPase 2416..2687 CDD:304359 166/273 (61%)
P-loop_NTPase 2764..3031 CDD:304359 171/267 (64%)
MT 3043..3386 CDD:289543 193/343 (56%)
AAA_9 3413..3626 CDD:289547 143/213 (67%)
Dynein_heavy 3766..4452 CDD:281078 449/687 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.