DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah9

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001353479.1 Gene:dnah9 ZFINID:ZDB-GENE-020925-1 Length:4464 Species:Danio rerio

Alignment Length:4586 Identity:2339/4587 (51%)
Similarity:3150/4587 (69%) Gaps:157/4587 (3%)


  Fly     6 EKKEPV--DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQL 68
            |::||:  |.|.::..|.:.|.:.:|.::|.:.::..|.|.||.|||:......:..::||.|||
Zfish     2 EEQEPLITDKRLDYLENCVLKALNVKPERWERCVSAEEQRRVIQEFLDQSEHSTLSVSVNSAGQL 66

  Fly    69 YPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVN 133
            .|:.......:.|..:|::..... ||.:.|...|..||:..:||...|:|.|:|..|:|:|..|
Zfish    67 VPALGLSAAVKSKAVFFVKRGKGA-LTADKMKTQLFSGDMCYSPLEQFSVLVDKVVEPVLSNLNN 130

  Fly   134 QVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMK 198
            |..:..|::.|:......::|.:....|.:..:|..|:|:...:..|.:..:.. ...||:..:.
Zfish   131 QRDFPKVVSQDLMRHIHALQNNVFVTAGQIKGKTHLPVPLGFKQFEQCSQQLDK-RFHVVDKSLI 194

  Fly   199 HSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIG 263
            ||:|.:|:.|...|..::...:.|.:....| |.|.|...||.:||.:|:.:.:||...::.|:.
Zfish   195 HSMETVVIDWSHQVYKVLKKDSSEPLLEGRN-PTPHAEIQFWRNRLADLQGIQQQLQSSKVLTLA 258

  Fly   264 FVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIG 328
            .:|..:.|.:..::.::::.|:|:..|:::||..|.||:|.::..|..|..|.::.|.|||.|:.
Zfish   259 ELLLAVDSSYYPAFAKMIQDVMEAHNESKNITTFLKPLERLIEDLENADFTELKAKIPPLMHTVC 323

  Fly   329 LVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIY 393
            |:|.:.||:.....:.:......|.||......:.||.|.:|||.|:..::...:..|.::|..|
Zfish   324 LIWANCRYYSKPARVIVLLQEICNLLIQQARSFLNPDDILKGDVLESLLRVQAAVDLLTHFKNTY 388

  Fly   394 NECRNSLKKFKIGTTFNSQD----WTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMG 454
            .:.|.:|..::     .::|    |.:....:|..||.|:.||..::.:..||.|..:||||..|
Zfish   389 EDRRANLSHYQ-----KNEDPVKPWDFSPLMVFVGLDHFMKRLRTIETVLLTVMDMMRLEKIEFG 448

  Fly   455 GLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMV----- 514
            |::|:.::..::::.|::...|:.::...|:.:  |..|..|:.|...|:...|...|.:     
Zfish   449 GIQGKSLSQIVQRLHEDFLQTYKSFSEKPYDCL--DVNNMEFESDFAEFQLTVDDTNRRLGAIFC 511

  Fly   515 -SFQFEKGLEDTHDLL-LAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALG 577
             :|....|||.:..:| :.|.||.:|:|....:....:::..|::::...|..|.....:....|
Zfish   512 NAFDDASGLEHSFKVLDMFGRLLEQPLIAAEAQARYPILIKLFDKQLEDCKTIFKKQMQMEETRG 576

  Fly   578 LNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFT 642
            .:  |.....|.|||.:.|:::|:.||..|:.......:|..::.....:...::.:::::..::
Zfish   577 YS--PVSKNMPAVSGGLKFVQELQERIQTLYNNFRFINHPCMESVDAKEMMQKYDELMRQLKQYS 639

  Fly   643 KMLLDKWTVECWQGIQQDITLTLIEKDEANE-LRVNFTERLIFALKDIKVVRLLGCDVSVN-LTK 705
            ..|.|.||....:..|.::...||.::..:. |.|||:.:|:..|:::|.:.....::..: ..:
Zfish   640 SKLYDIWTSSVAEKSQFNLNKPLISREPRSRLLSVNFSPQLVSVLREVKYLEARQAEIIPDAAAE 704

  Fly   706 FFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQ--- 767
            .:...:.|||....|.....|||.........|..|:..::..|:.::|...:.:.|  .|:   
Zfish   705 IYSSRELLWQYVANLELTTGWYNKIISSVLDVEMPLVQGQLTDIDNKLKGAQENLCW--ISEGIW 767

  Fly   768 RFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAA 832
            .:|..:.:.|..|..||...::|:|.::..::||. .||..||:....:||:.:.|...:....:
Zfish   768 EYIQDVREAVSDLEQRLRRTKDNVEEMQSLMKSWA-TPLHDRKEGKKEMLLNLEERSERVERTYS 831

  Fly   833 NAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREV 897
            :...:...|.||:..||.||                :.:.|...|                    
Zfish   832 HIRSSGARIHLLLQENLHLF----------------KADPSSPQW-------------------- 860

  Fly   898 IDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSS 962
                                                      :.|..||||::.:...:: |.|:
Zfish   861 ------------------------------------------KIYVDYVDEMVIDGFFNA-IEST 882

  Fly   963 TYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVA 1027
            ....||..:......|:||..:.||.|::|:..:|:..|.......:|.:|.|:....:|:.|:|
Zfish   883 LKFFMENTDADAGLEPLFEAQLRLQVPDLVFQPSLELRSSDSLHELVEGLLRDVFKTSTLVPRLA 947

  Fly  1028 QD---PTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKST 1089
            :.   |         .:.|:::|..||.:.|..:|.::|..:.....:......::.|::.|:..
Zfish   948 KHSGFP---------DYQDDMEDMEELVQTRQHVMQRVKRIMMKCCEYRNSLERYAYLYVDDRKE 1003

  Fly  1090 YLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPP-LSVYKEQLDKFIELQDQIRTWETYED 1153
            ::.:...:|..||..|.:..|:    .||.    |.|| |..:::|:|.:..|.::::..|....
Zfish  1004 FMRQFLLYGHVLTSQEIEEHAE----HGVP----ESPPTLERFRQQVDSYERLYEELQRMEPVMV 1060

  Fly  1154 FFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFV--DEANIVLKIELQKDDFE 1216
            |..::|::...||.|:|:.|.:|..:||..||:.|.|||.:|::|:  .||.:..|:|  :.|:.
Zfish  1061 FERWMRVDARAFKSALLNTVKKWSLMFKQHLIDHVTNSLSDLEEFIRLTEAGLGQKVE--EGDYR 1123

  Fly  1217 GLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATT 1281
            |||:|:..|..:.|:|...|.||:||::.||||:.|..|..|....|:..||:.|..:|:.|...
Zfish  1124 GLVEIMGFLMAVKERQSSTDEMFEPLQQTIDLLKTYEQELPDVVYKQLEVLPEKWNNMKKQAVQV 1188

  Fly  1282 KQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQR 1346
            ||.:||:|:.:|..:.:|....|...:|:|:.|..|.||....::.:|.:|.:..::..||....
Zfish  1189 KQHVAPLQAAEVANLRRRCAAFDVEQHTFRETFRKKHFFRFDSVNVHEQLDTTHTQIQELESLMA 1253

  Fly  1347 SLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKK 1411
            .|.|||.|||:..||..:::.||.:|.|:|.:||.|:.::|.:..|::|||.:|::::|:.|||:
Zfish  1254 GLTESANLFEVGVPDYRQLKQCRRELPLLKELWDQALAVRSCLEAWQRTPWSQINVDDMETECKR 1318

  Fly  1412 FGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDST 1476
            |.:|||.|||..|.|:.|..::..:||.:||||||.||||||||.|||.:||..|.|:|:||..|
Zfish  1319 FSKELRLLDKEARAWDVFNGLDGMVKNTLTSLRAVAELQNPAIRPRHWQQLMAATGVQFTMDQDT 1383

  Fly  1477 TLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEEL 1541
            ||.||:.||||.:||||:.|||::||||.|||.|.::...|.:|.|..:.|.||.:.|||:||||
Zfish  1384 TLADLLRLNLHHFEEEVRGIVDRAVKEMGMEKVLGELDATWTSMSFEFEAHPRTQVPLLKSSEEL 1448

  Fly  1542 IETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIR 1606
            ||||||:|.||||:.|||||:||..||..||.:||..|.:|..||||||.|.:||||||||:|||
Zfish  1449 IETLEDNQVQLQNLMSSKYISFFLEEVSSWQRKLSVTDSVISIWFEVQRTWCHLESIFIGSDDIR 1513

  Fly  1607 SQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLET 1671
            |||||||:||:.||.:|:.|........|||.:||:.|  ||..||.:...|.||||||::||:|
Zfish  1514 SQLPEDSKRFEGIDGDFRELTLDARQTPNVVEATNKPG--LYSKLEDIQSRLALCEKALSEYLDT 1576

  Fly  1672 KRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISG-----SKNAAGMVAKEL 1731
            |||::|||||:||||||||||:|.:|..|.:||:||:|:|.||...:|     .|.|.||.:|| 
Zfish  1577 KRLAFPRFYFISSADLLDILSSGTDPHQVQKHLSKLFDNMAKLQFQAGEDGGLQKTALGMFSKE- 1640

  Fly  1732 EEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQI 1796
            :|:|||...|||:|:|||||||:.|.||.|:|.::..::..|:.|||..|:|::|||.||..|||
Zfish  1641 DEHVPFSHACDCTGQVEVWLNRVMDSMRATVRHEMTEAVAAYEEKPREQWLFDYPAQVALTCTQI 1705

  Fly  1797 MWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVV 1861
            .|||:...||:::::.||||:|:|.|||:.|||.||.:|:|.||..:|||:|||||||||:||||
Zfish  1706 WWTTDVGMAFSRLEEGYENAMKEYYKKQVNQLNTLITMLIGQLTPGDRQKVMTICTIDVHARDVV 1770

  Fly  1862 GTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYIT 1926
            ..||.:|||...||.|.|||||||..:...||||||||||.|.||||||||||||||||||||||
Zfish  1771 DKIITQKVENSQAFLWLSQLRHRWGDREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYIT 1835

  Fly  1927 LTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGC 1991
            |||||||||.|||||||||||||||||||||||:|||||||||||||||.|:|:|||||||||||
Zfish  1836 LTQSLHLVMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGC 1900

  Fly  1992 FDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPEN 2056
            ||||||||||||||||||||.|||||:.|||.|:|:||.:.|..:||:|||||||||||.|||||
Zfish  1901 FDEFNRISVEVLSVVAVQVKSIQDAIRDKKQRFNFMGEDVCLVPSVGIFITMNPGYAGRTELPEN 1965

  Fly  2057 LKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSV 2121
            ||||:||||||||||.||.|||||||||.|||||||||||||.||||||||||||||||||||||
Zfish  1966 LKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSV 2030

  Fly  2122 LVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVI 2186
            |||||:|:|.|..|.|||||||||||||:|||||||:||||||||||||||||||||:.:||.::
Zfish  2031 LVVAGSLKRGDPGRAEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDMDFEKLV 2095

  Fly  2187 KRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDL 2251
            ::|.|:||||.||.|:||:||||||.|||||||::|.||||||:|.|:|::||||.:|:..::||
Zfish  2096 RQSVLELKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLHRTYQNMQRRAVWSDL 2160

  Fly  2252 NPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDN 2316
            |||||||||||||:||:||||:|||||.:||:.||:..:||||||||||||||||||||||||||
Zfish  2161 NPKAVTNDELFGIINPATREWRDGLFSNIMRELANITHSGPKWIVLDGDIDPMWIESLNTVMDDN 2225

  Fly  2317 KVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSE 2381
            |||||||||||.|...|||||||:.|||||||||||||||||||.||||.|.:.||:.:|...||
Zfish  2226 KVLTLASNERIPLNPSMRLLFEISHLRTATPATVSRAGILYINPADLGWNPLVSSWIDSREVQSE 2290

  Fly  2382 VSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFV 2446
            .:.|.:|||||:|..||..|.|.:.|.|:.:.:::||.|.||:.:|.|::.|.|..||.||:|||
Zfish  2291 KANLTILFDKYLPSCLDTLRVRFKKIIPVPEQSQVQMLCRLLECLLVPEHTPPDSHKDLYELYFV 2355

  Fly  2447 FCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFE 2511
            |..||.||.::||||::|:..|||||::.|:|:||||..|::|.:|||.::|||.||:.:||:||
Zfish  2356 FAAVWAFGGTMFQDQLLDYRLEFSKWWVTEFKSVKFPAQGSVFDYYIDPDSKKFEPWSKMVPKFE 2420

  Fly  2512 LDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNV 2576
            :|.::|||:.||:|.||.|:|:|:|.|:|...||||:|.:|:||::|:..||::|.::||::.||
Zfish  2421 MDPEIPLQACLVHTTETIRVRYFLDRLLERRRPLMLVGNAGTGKSVLVGDKLASLDAEKYTIKNV 2485

  Fly  2577 PFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDY 2641
            |||:||:|.|||.:|||||||||||||||.|:||::||:|||||||||:|.||||||||||.|||
Zfish  2486 PFNYYTSSAMLQAVLEKPLEKKAGRNYGPPGSKRLVYFIDDMNMPEVDEYGTVQPHTLIRQHMDY 2550

  Fly  2642 HHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHM 2706
            .|||||.|:.|::||....|:||||:||||||:||||||||.||::.|..|||..|..||||||:
Zfish  2551 SHWYDRSKLQLKEIHNVQYVSCMNPTAGSFTINPRLQRHFCVFALSFPGADALHSIYCSILSQHV 2615

  Fly  2707 DNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCP 2771
            ..  :.|..:|.|.|..:|..|:.||.::.::||||||||||.|||||::|||.|:|:..||...
Zfish  2616 RG--ESFSVSVQKSCSQLVDLALALHQRITTAFLPTAIKFHYIFNLRDLSNIFQGILFCGSECLR 2678

  Fly  2772 NSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLI---YCHFAK 2833
            ....::::::||..|||.||:::..|...|.|:..|.|:|..|.|  |.:..:..:   :|||:.
Zfish  2679 TPQDLLKIYLHESSRVYRDKMLEERDFQLFDKLQEDTVKKIYEDV--DALLQETRVMNLFCHFSA 2741

  Fly  2834 GLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGV 2898
            |:.:.:|:|:..|..|...|.||.:.:|:...||:||||:|||:|:|||||||||.||.|||:||
Zfish  2742 GVGEPRYLPVPTWSSLAHTLQEALEAHNELNPAMSLVLFEDAMAHICRISRILESPRGNALLVGV 2806

  Fly  2899 GGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQ 2963
            ||||||||||||:||||||||||.|.|.||:.|||:::.:||:|||||......||||::||.|:
Zfish  2807 GGSGKQSLTRLAAFISSLDVFQITLKKGYSIPDLKSDLGSLYIKAGVKNIGTVLLMTDAQVADEK 2871

  Fly  2964 FLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFS 3028
            ||||||||||||:|.:||||||||||:.::||||:..|::|.|:|||::|||:||..|||.||||
Zfish  2872 FLVLVNDLLASGEIPDLFPDDEVENIIGSLRNEVRAQGLMDTRDNCWRFFIERVRRQLKVALCFS 2936

  Fly  3029 PVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKT 3093
            |||..||||||||||:||||.|||||||||:||||||||||.::..:..||..|||.|||:||.:
Zfish  2937 PVGNKLRVRSRKFPAIVNCTAIDWFHEWPQEALESVSLRFLQDLEHIQPELKEPVSKFMAYVHVS 3001

  Fly  3094 VNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRL-RLENGLIKLASCTKEVDA 3157
            ||..|:.||.|.:||||||||||||.|.||..||..| |.:|..:: ||||||.||.|.|.:||.
Zfish  3002 VNKTSRDYLLNERRYNYTTPKSFLEQIKLYGNLLALK-KRDLQSKMERLENGLEKLNSTTAQVDD 3065

  Fly  3158 LQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDF 3222
            |:..|..||||||:||:.||.||.|||.|.|||.:|||.|.:||:.|..|.|:|..|.:.||||.
Zfish  3066 LKAKLAAQEVELKLKNESADRLIQVVGVETEKVERERAVADQEEQKVACIAEEVMRKQRDCEEDL 3130

  Fly  3223 LKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFM 3287
            .||:|||||||||||||||||||||||||:|..||.:|..||:||.:..|::|||||||:.:..|
Zfish  3131 AKAEPALIAAQEALNTLNKNNLTELKSFGAPVSAVTNVTAAVMVLTAPGGRVPKDRSWKSAKVMM 3195

  Fly  3288 GNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYL 3352
            ..||.||:.||.:.|::||.:.:||:|||:.|.||.||.:.:||:||||||||||||.|||:||.
Zfish  3196 AKVDAFLEALITFKKENIHENCLKAIQPYLQDPEFQPELVASKSNAAAGLCSWVINIVRFYEVYC 3260

  Fly  3353 VVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTI 3417
            .||||.:||.::..::..|::||..:..::|.|.|.|..|..::::|.|.|.:||.||..|..||
Zfish  3261 EVEPKRQALSKANTDLATAQEKLAVIKAKITLLNENLAKLTAKFEKATADKLRCQQEAETTERTI 3325

  Fly  3418 DIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAF 3482
            .:||||:|||:.||:||.|:|:|.....:.|.||:|:|:.|:||:|.||:.||.:|.:..|.|..
Zfish  3326 ALANRLVGGLSLEKVRWAEAVQVFQQQERTLCGDVLLITAFVSYLGYFTKHYRLQLMDHCWRPYL 3390

  Fly  3483 KNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKW 3547
              ||..:|.|:|:||..|:.|||..|.|.|:|||:||||.|||.||...||:|||:||||||::|
Zfish  3391 --SQLQVPVTEGLDPLSMLTDDADRAVWQNEGLPADRMSTENATILSSCERWPLMVDPQLQGVQW 3453

  Fly  3548 VKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGD 3612
            ::.:|...|.::|:.||.|||.:|||:|.|.|:||||:.|::||||.|||||:.||||..:||||
Zfish  3454 IRNRYAERLRIIRIGQRGYLDSIERALSVGEVVLIENLEESVDPVLGPLLGRETIKKGRCIKIGD 3518

  Fly  3613 REIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRL 3677
            :|.::|..||||||||||||||:||:|||.||:|||||||||||||||.||.:||||||.::..|
Zfish  3519 KECEYNPSFRLILHTKLANPHYQPELQAQCTLVNFTVTRDGLEDQLLAAVVSMERPDLEELKLNL 3583

  Fly  3678 TQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDS 3742
            |:|||.||||||.|||:||:|||||..|.|.|:.||.|||.||.||.|||.||.|||.|...|:.
Zfish  3584 TKQQNGFKITLKTLEDNLLSRLSSASGNFLGDIELVENLETTKCTAAEIERKVKEAKGTETDIND 3648

  Fly  3743 AREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSIT 3807
            |||.|||||.|||::|||:|||.||:|:||||||||:|||..|:.||...|.||.||.|||||||
Zfish  3649 AREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVQKAEPDESLKQRVCNLIDSIT 3713

  Fly  3808 FCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGG 3872
            :|.|.||:|||||.|||.:..||..|:|:...|:.|.|||||||:|..|...|...:|::..|||
Zfish  3714 WCVFQYTTRGLFECDKLTYTAQLAFQVLLMNREISPHELDFLLRYPVQPGLISPVDFLSNHSWGG 3778

  Fly  3873 IRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYA 3937
            |:||:....|..|::|||||.||||||.:||.||.||||.|||.|:|:||||:||.:|||||:||
Zfish  3779 IKALSTMEEFHNLDRDIEGSAKRWKKFSESECPEKEKFPQEWKSKTALQRLCMMRALRPDRMTYA 3843

  Fly  3938 MRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFH 4002
            :|.|:||||||.|:..||::||.::|||...|.:||:|||||||||||||.|:.||::||:.|||
Zfish  3844 VRDFVEEKLGSAYVTGRSLDFSVSYEESGSATPMFFILSPGVDPLKDVEKHGRKLGYTFDNRNFH 3908

  Fly  4003 SVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPA 4067
            :||||||||:|||.|::.|::.|||||||||||||:||.|||||:|......|..:|:|:||||:
Zfish  3909 NVSLGQGQEVVAEQALDTAAREGHWVILQNIHLVAKWLGSLEKKLEQHAEGSHQDFRVFMSAEPS 3973

  Fly  4068 GDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAV 4132
            ..|..||:||||||:||||||||||||.||:|||||||:.:|||||.:|.|||:|||:|||||||
Zfish  3974 SSPDGHIIPQGILENAIKITNEPPTGMHANLHKALDNFTQDTLEMCVRENEFKSILFALCYFHAV 4038

  Fly  4133 VAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRR 4197
            ||||||||||||||.||||.|||||||.|||||||||::||::||||||||||||||||||||||
Zfish  4039 VAERRKFGPQGWNRVYPFNTGDLTISVNVLYNYLEANSKVPFDDLRYLFGEIMYGGHITDDWDRR 4103

  Fly  4198 LCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTT 4262
            |||.||:||::||:::|||....||..|....|:|||.|||..||.|||.|||||.||||||||.
Zfish  4104 LCRAYLQEFIRPEMMEGELMLAPGFRLPTNTDYSGYHQYIDAALPPESPYLYGLHPNAEIGFLTQ 4168

  Fly  4263 VSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIV 4327
            .||:|||.|.|:||| .||:..|...::::.:|..:::||:|.|..||:.|||.:||:||||::|
Zfish  4169 TSEKLFRTVLEMQPR-DGGAGDGAAGARDEKVKAALDEILEKLPEEFNMSELMAKVEERSPYVVV 4232

  Fly  4328 AFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQS 4392
            |.|||||||.|..|:||||.||:||||||||:||.||.|...||:||||:.||:.||||:.||..
Zfish  4233 ALQECERMNTLTQEIKRSLRELNLGLKGELTMSSDMESLQSALYLDQVPDSWTRRAYPSLCGLAV 4297

  Fly  4393 WFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKW 4457
            |||||..|:||||.|.:||.:|:::||||||||||.||||||..||:|:||||||.|.||||||.
Zfish  4298 WFSDLQSRIRELESWSSDFCLPAAVWLAGFFNPQSFLTAIMQAAARRNQWPLDRMSLQCDVTKKS 4362

  Fly  4458 KEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECP 4522
            :||.::||||||||:||:|||||||.:.|.:.||.||||.||:|||:||||..||||.:::|:||
Zfish  4363 REEFSSAPREGAYIHGLYMEGARWDTQAGVVTDARLKELTPALPVLFIKAVPVDKQDTRSLYQCP 4427

  Fly  4523 VYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLLQ 4558
            |||.|.||.|.||||:||:::..:|||||||.||||
Zfish  4428 VYKTRQRGHTHVWTFSLKTKDNPAKWTLAGVALLLQ 4463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 136/579 (23%)
DHC_N2 1368..1770 CDD:285579 224/407 (55%)
P-loop_NTPase 1903..2132 CDD:304359 201/229 (88%)
P-loop_NTPase 2217..2352 CDD:304359 103/135 (76%)
P-loop_NTPase 2510..2783 CDD:304359 157/273 (58%)
P-loop_NTPase 2860..3127 CDD:304359 183/267 (69%)
MT 3140..3480 CDD:289543 183/340 (54%)
AAA_9 3509..3722 CDD:289547 139/213 (65%)
Dynein_heavy 3864..4549 CDD:281078 450/685 (66%)
dnah9NP_001353479.1 DHC_N1 194..769 CDD:312031 137/587 (23%)
DHC_N2 1281..1678 CDD:312039 221/400 (55%)
P-loop_NTPase 1812..2042 CDD:328724 202/230 (88%)
P-loop_NTPase 2126..2261 CDD:328724 103/135 (76%)
P-loop_NTPase 2419..2690 CDD:328724 157/273 (58%)
P-loop_NTPase 2768..3035 CDD:328724 183/267 (69%)
MT 3047..3390 CDD:330758 184/343 (54%)
AAA_9 3416..3629 CDD:315453 140/213 (66%)
Dynein_heavy 3767..4461 CDD:308587 456/695 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C354995267
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46532
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.