DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and kl-3

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001104482.3 Gene:kl-3 FlyBaseID:FBgn0267432 Length:4593 Species:Drosophila melanogaster

Alignment Length:4726 Identity:1352/4727 (29%)
Similarity:2281/4727 (48%) Gaps:569/4727 (12%)


  Fly   127 LLNNTVNQVG-WTNV--IANDMKTESQEMRNGIA--QMKGLVINRTIFPLPICMDEVM----QAA 182
            |.::.|:.:| ||.|  :.|:...:::.:.:.:|  .:.....|..:..:...||.|:    :|.
  Fly   137 LRSDLVDLIGKWTVVYRLNNEKSIDNRSVSDEVAIFMISAEERNSCLNVVKTFMDHVLKPSIEAV 201

  Fly   183 PAIAMGD----------ISVVNPLMK---------------HSL--EFMVVKWLDSVEDLVNIKA 220
            ....:.:          :::.|..:|               |.|  ..::|:|        .|:|
  Fly   202 TEFGLAEKEQTQKFFHILNMYNTFLKSSEATVSSRVNFDISHELFKGLLLVRW--------QIEA 258

  Fly   221 GEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIG---------FVLEKIQSIFE-- 274
            ..||.::..  |.|..|..|..:::.:....:|: .|....:|         .:|.:..:|.|  
  Fly   259 SSKILTRVR--LVERYFEQWLRQIQGILVEGKQI-QRDTPDVGPLQMLVNWRRMLARYTTITEFV 320

  Fly   275 ---------------------HSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRS 318
                                 :.:..|...|..:|.||:|..:.:|.|::..|....:..:...|
  Fly   321 TSRAFNNHKDCLTLSRSSKLLNRWAEIDNQVTLALNEAKDNVRYISSLQKFWDPLYRSSPNVIIS 385

  Fly   319 DIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINM 383
            .:..||:.|..|...:.||:|..|:|.......|.|      |:...:..   .|..:.|:    
  Fly   386 SLPGLMVAIRNVSKTAHYFNTPVNVTGLMVKISNQL------TITSKNYI---TDNEHSKV---- 437

  Fly   384 QHLEYYKLIY----NECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRD 444
              :|.||.||    :|.:||          |.:.||.....|...|.|||.|||::|.:.||...
  Fly   438 --MENYKNIYIHTVDEMKNS----------NERPWTVSSVYILTCLQKFLQRLEKVKWIANTDIT 490

  Fly   445 FQKLEKIVMGG-------LKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLS 502
            :..|::|::.|       :||.::|.:.:                .|:|:     |...:...|.
  Fly   491 YSILDRIMISGMERFNAMIKGARMTISSQ----------------LYDPL-----NYRIETFDLD 534

  Fly   503 FKAKTDVMERMVSFQFEKGLEDTHDLL-----LAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCV 562
            |:...:.:|     :.|.|::....||     .|.|::|   :.|..|.|        ..|.:|:
  Fly   535 FEKFVNEVE-----EAEVGMQQFVKLLSTECPSAASVML---VLKRFEAL--------SLECLCL 583

  Fly   563 KKEFIN-----------FKNVFTALGLNE------LPTDDCFPKVSGAISFLK------------ 598
            .:.::.           .|:|:     ||      :|.:  .|.|:|.|.:::            
  Fly   584 DRRYLEVAEMLEREMFLLKDVY-----NEERGNPFIPRN--LPPVAGRIIWIRSIFKKIDLPMQA 641

  Fly   599 -KLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDIT 662
             |||..::...|......|              :|.|...|..: :|...|    .|....:::.
  Fly   642 LKLRQCVLAHKKAQRTVRY--------------YNYMNGIICHY-EMAYHK----AWFDYVEEVR 687

  Fly   663 LTL------IEKDEANELRVNFTERLIFALKDIKVVRLLGCDV-SVNLTKFFCREDELWQA-RVK 719
            ..|      |.|:||..: ||....::..:.:.:.:..|..:| ::..|..:|::..|..| .:|
  Fly   688 CLLNAPIMTINKEEAIYI-VNIDRAILQLISETEWMWKLNLEVPNMAATITYCKDRLLGPATTLK 751

  Fly   720 LMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFS-QRFIVMIFKMVKYLHD- 782
            ||  .:.|:.......|....::...:..|...:||.|..:.|.:.: :.::..:...:|.:.. 
  Fly   752 LM--LQRYDRLRTSLTPVFINIMRFRLQEISILLKPSLSTVTWISENLEDYVEKVCMKIKEVETF 814

  Fly   783 -RLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQR------- 839
             .|:...|:|..::|..            .::..|.::. |.||:.|......::..|       
  Fly   815 FNLILDIEDLRILQEMY------------SISDYLYIYV-PEEPVSSYEFVEESNKLRSEIERIL 866

  Fly   840 ----------LIDLL-MYVNLKLFFDIP----RRYSLPPGEHGEEDEESDGIWPPIISLSVMTSV 889
                      ::|:: |:::|..|....    |.:.|||.:..:.:..::|..|    :.....:
  Fly   867 EKKSVCMERAVVDIINMFIDLLDFEQTDSKGRRVFQLPPEKLNDTNWRTEGFLP----IDKWDFI 927

  Fly   890 KFKK--KREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAE 952
            :|.|  :...:..||.|...   |..:.|.|     ||||.. |..:...||..|...:  |:| 
  Fly   928 QFHKIYRTIYLAPEDVLRTL---QFRNYENI-----RYELYH-LRNDCMDLFSYYNSKI--ILA- 980

  Fly   953 NLVDSVITSSTYLRMEV-DNRYENN--TPIFEIFMELQEPNVVYFR-NLDTSSKTGFAFFIETIL 1013
             ||.....|..::|..: ...:..|  .||....:|:...|..|.: ||            |.:.
  Fly   981 -LVAGSKRSLDFVRQNILRTNWRTNPMKPILHTDLEIDFYNGCYIQPNL------------EIMQ 1032

  Fly  1014 DDMNNMMSLLKRVAQDPTE----VTNMNPYSFYDELQDKS-ELDKQRVE------IMNKIKLALQ 1067
            :|.||.:...       ||    |:.....:...|.:|:. .:|:.:.|      :|.. |..::
  Fly  1033 NDFNNAVLCC-------TEINYFVSTWGKQAKTQERRDRRVTVDENKYERSYFRYVMEH-KDVIR 1089

  Fly  1068 AVRVHGKGFMEFSS---------------LWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSG 1117
            ||:....|.:.:.|               ||..|:...::.. .....||:|.||          
  Fly  1090 AVQNLANGLLSYKSDMEEFQRDMFEKYKYLWAEDREDIINSF-VLTNPLTVDIRD---------- 1143

  Fly  1118 VKLLGLEYPPLSVYKEQLD-KFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFK 1181
               :.|.|..:|:..|.:. |.|....::|...|.|               .::|:..:|..|..
  Fly  1144 ---MFLHYDNISLKIETMSAKRIIGPIEVRMGSTIE---------------KLVSESKKWKVLLG 1190

  Fly  1182 LDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEII 1246
            ..|..:.|..|.|:.:|:.|.|.:|...:  :|.:.:.:.:.||.::.:.....|.....:.:..
  Fly  1191 HLLSVQYKKQLDEMIEFITEQNNILDKPI--NDLDDVRQAMVVLEKVRDNYIEMDVSLQLITDTY 1253

  Fly  1247 DLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYR 1311
            .|..|:.......:..::..|.   :...::....|::...|...:..|:.:   |.|.:| |:.
  Fly  1254 SLFSQFYIYVPQEDYDKVEGLQ---VLFNKMLENAKKVSDRISEMEEPLLRE---LNDGIA-TFV 1311

  Fly  1312 KKFLSKKFFF------VPCLSCYELIDESDLELVALEERQRSL---AESAVLFELQGPDPVKIEL 1367
            ::|......|      |..:|..|..|...|.....:|..|..   :....||.|...|...:..
  Fly  1312 QEFYDFNLDFDLNGPMVEGISAKEASDRVFLFQNRFDELWRKFEMYSSGEKLFGLPITDYPLLHQ 1376

  Fly  1368 CRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFM 1432
            .:.:...:..::...|.:..||.|:.:.||..::||.:..|...|....|.|.|.|::|..||.:
  Fly  1377 RKREFNYLNRLYSLYIQVLKTITDYYEMPWADVNIEKISAELSDFQLRCRKLPKGMQSWPAFIDL 1441

  Fly  1433 EASLKNLMTSLRAVTELQNPAIRDRHWIEL-------MQTTKVKFSMDDSTTLKDLIDLNLHEYE 1490
            :..:.:...:...:..:.|.|:::||||.|       ...|..||      ||..|::..:.:|:
  Fly  1442 KTKIDDFNETCPLLELMTNKAMKERHWIRLNALFNTDFDPTNPKF------TLGKLLEAPILKYK 1500

  Fly  1491 EEVKNIVDKSVKEMAMEKQLRDIATAWG--TMEFGTDIHDRTSIKLLKASE--ELIETLEDHQGQ 1551
            |:|::|...:.||:.:|.:|:.|.:.|.  :::.| ...:|..: :||..|  |:|.:|||....
  Fly  1501 EDVEDICVGASKELDIEAKLKQIVSDWSLVSLQLG-QFKNRGDL-VLKGGETLEIISSLEDSLMI 1563

  Fly  1552 LQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRF 1616
            :.::||::|.|.|:.:::||.::|.|...|:..|..||..|.|||::|:|. ||..|||.:::||
  Fly  1564 MNSLASNRYNAPFKKDIQLWLSKLVNTGDILEKWLMVQNLWIYLEAVFVGG-DISKQLPMEAKRF 1627

  Fly  1617 DYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYF 1681
            ..|||.:..::.:.....|.|.......| |..:|..||..|..|:|:|..|||:|||.:|||:|
  Fly  1628 TNIDKSYVKIMMRAREIPNAVDCCTGDES-LATNLTWLLDQLETCQKSLTGYLESKRLVFPRFFF 1691

  Fly  1682 VSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLENCDCSGK 1746
            ||...||:||...::|..:..||..::|::..::....|.:....:.....|.|.|.....|.|.
  Fly  1692 VSDPVLLEILGQASDPTSIQPHLLSIFDAIATVDFQEKSIDIIESMNSMNREKVKFENTVQCLGS 1756

  Fly  1747 VEVWLNRITDKMRDTLRDQL-KRSLTFYDHKPRHVWIFEWPA---QPALVGTQIMWTTETNDAFA 1807
            ||:||.|:..:|:||:|..| :.|::..|  |...:..|:|:   |..:||.|::||.::..|..
  Fly  1757 VELWLGRLLKEMQDTIRTILAQMSVSLND--PEFNFAEEFPSFCGQAGVVGVQLLWTKDSEYALR 1819

  Fly  1808 KVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQ 1872
            |.:.. :..:|..|.|.:..||..|.|.:.|||:.:|.:..|:.||.||.||:...:...:::..
  Fly  1820 KCRTD-KTIMKRTNNKFLVLLNFFIDLTVKDLTSLDRIRFETMVTIHVHQRDIFDDLCTLRIKSA 1883

  Fly  1873 TAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGG 1937
            ..|:||.|.|..::...||....|.|..|.|..||||.|.||.||||||||||||.|::.:.|||
  Fly  1884 GDFEWQKQARFYYNEDNDDVIVGITDVNFVYQNEYLGVTERLAITPLTDRCYITLAQAVGMCMGG 1948

  Fly  1938 APAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEV 2002
            ||||||||||||||||:|||||.:|.|||||:|||::.:|.|:|||||:|:||||||||||.:.|
  Fly  1949 APAGPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPV 2013

  Fly  2003 LSVVAVQVKCIQDAIKSKKQTFSFL-GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAM 2066
            |||.|.|:..:..|.|.|:.||.|| |:.::|....|:|||||||||||.|||||||.::|..||
  Fly  2014 LSVAAQQIYIVLTARKEKRSTFIFLDGDIVSLNPEFGIFITMNPGYAGRQELPENLKIMFRTVAM 2078

  Fly  2067 VVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRD 2131
            :|||..:|..:.:.:.||:|..:|:||..|||.||:|.||||.|||:|||.|.|||...|:.:|.
  Fly  2079 MVPDRQIIIRVKMASCGFKENVVLSRKMYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGSQKRS 2143

  Fly  2132 DRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQ 2196
            :....|:.::||.|||.|:.|::.:|..:|:.|:.|:||.:.:......:.:..|      :|:.
  Fly  2144 NPNDTEETIVMRVLRDMNVSKLIDEDEGLFVSLVDDMFPGIKLTTNVYKDLQKAI------IKVC 2202

  Fly  2197 PEDGFI------LKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKA 2255
            .|.|::      ||:|||.|...|||.:.::|..|:||:.....:.:.:....|......:||||
  Fly  2203 DELGYVNNPEWNLKVVQLYETSLVRHGLMLMGPTGSGKTSCTVCMLRCFTEMGRTHKEMRMNPKA 2267

  Fly  2256 VTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLT 2320
            :|..::||.::.:|.:|.||:||.|.|....:......||||||.:|.:|||:||:|:||||.||
  Fly  2268 ITAPQMFGRLDVATNDWTDGIFSTLWRRSLKVPQHQNCWIVLDGPVDAVWIENLNSVLDDNKTLT 2332

  Fly  2321 LASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEV--S 2383
            ||:.:||.:....:|:||..::..|:||||||.|:::.:...|.|..::::||..:...|||  .
  Fly  2333 LANGDRIKMADNSKLVFEPDNVDNASPATVSRVGMVFTSSSVLSWKIYMEAWLLKQGEDSEVFRR 2397

  Fly  2384 MLNVLFDKYVPPLLDIF-RTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCP---KDWYEIY 2444
            ..:||:|.     ..:| ::||.:...|.:...::....::|.:|.      |.|   :...|..
  Fly  2398 CYDVLYDD-----AHVFLQSRLLAKMRILEAIYIRQMLDIMDGLLL------DLPLRTEKALERI 2451

  Fly  2445 FVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSG---TIFSFYIDHETKKFFPWTNL 2506
            |:|.::|..|:.|...:    ..:..::.|.....:::|..|   |||.:|:| :...:..|:..
  Fly  2452 FLFSLMWSLGAVLELSE----REKLEEFLLKHVSKLRWPKRGVNETIFEYYVD-DNGNWQHWSTR 2511

  Fly  2507 VPQFELDMD-LP-LQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSD 2569
            |.:|....| :| ..|.||...:..|..|.:..:.:....::|||..|:.||:::.|.:.....:
  Fly  2512 VEEFRYPEDEIPEFSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPE 2576

  Fly  2570 KYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTL 2634
            .:...:..|:..||..|.|||:|..:||:.|..|||...:.|..|:||:|||.::::.....:.:
  Fly  2577 VHIFKSFNFSSATTPNMYQRIIESYVEKRQGTTYGPPNQRAMTIFIDDINMPVINEWGDQITNEI 2641

  Fly  2635 IRQFMDYHHWYDRQK----MTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALF 2695
            :||.::...:|..::    .|:.||..  :.|.::|..|...|..||:||.|.|....||.:::.
  Fly  2642 VRQMIEQRGFYSLERPGDFSTIMDIQM--LSAMIHPGGGRNDIPNRLKRHLCIFNCTLPSNNSMD 2704

  Fly  2696 HILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFT 2760
            .|..||.:.:. :|.:..|: |:::...:|.........|.:..|||...|||.|||||::.|:.
  Fly  2705 QIFKSIGAGYF-SPDRLGDE-VVEVIPLLVPLTRIFWQNVKAKMLPTPANFHYVFNLRDLSRIWE 2767

  Fly  2761 GVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSF-KKIVSDI---------------- 2808
            |:|....|.|.:.:|:::||.|||.||..|:.....|...| .|::||.                
  Fly  2768 GILKVKHEECKSVDQILKLWCHECTRVISDRFTAEKDKIWFSSKMISDAELNIKEFMEFYPEEPT 2832

  Fly  2809 --------VRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIG 2865
                    ..:|.|..::::.:..|.|            |..|..:|.::|.:.....::|:||.
  Fly  2833 YWVDFLRDAPEGQEEEDEEMSFEPPKI------------YEEIPSFDFVRSKVLVFMSQFNEYIR 2885

  Fly  2866 A--MNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYS 2928
            .  |:||.|.||:.|:..:|||:.:.||.|||:|||||||||||||:|||:....||:.||:.|:
  Fly  2886 GYNMDLVFFMDALKHLMIVSRIISNPRGNALLVGVGGSGKQSLTRLSSFIAGYKFFQMTLTRSYN 2950

  Fly  2929 VSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAV 2993
            ..:|..::..||..||:..:...|:.|.:|:..|.||..:|::|:||:|..||..||::.:.:.:
  Fly  2951 TGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILSSGEIANLFAKDELDEMYSEL 3015

  Fly  2994 RNEVK--QLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEW 3056
            ...:|  |......::|.:.:||.:.|..|.:.|||||||...|:||.|||.|::...||||.:|
  Fly  3016 IPVMKKHQPRRPATQDNLYDFFISRARYNLHIALCFSPVGEKFRMRSLKFPGLISGCVIDWFQKW 3080

  Fly  3057 PQQALESVSLRFLSEITVLPKE-LALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELI 3120
            |:.|..:||..:|::..::..| :...|.:.|:::|::|.:....|....:|..:.||||.:..:
  Fly  3081 PEDARIAVSRHYLTDYQIVCSEKVKDQVIDIMSWIHESVQETCLSYYDRFRRVTFVTPKSLISFL 3145

  Fly  3121 ALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDAL-QDVLKVQEVELKIKNQEADNLIIVVG 3184
            ..|..|..:|....:....|:.:||.||......|..| :|::::.:| :.:.::||::::..| 
  Fly  3146 ESYKLLYKDKQDHIVIMSERMSSGLDKLDEAGASVAILKKDLIEMNKV-IALASEEAEDVLATV- 3208

  Fly  3185 TENEKVSKE--RAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTEL 3247
             |..|.:.|  :...::::.....:.::::|...:.|....||.|||..|:.||.|:...::..:
  Fly  3209 -EQSKAAAEIVKVEVAEKKGQAEVLVKNISAVKHVAEAKLEKALPALEEAEAALKTIKAADIATV 3272

  Fly  3248 KSFGSPPDAVVSVCGAVLVLFSSKGK-IPKD-------RSWKACRAFMGNVDKFLDNLINYDKKH 3304
            :..|.||..:..:...|.:||..|.| |..|       .||......|.:. .||..::.|....
  Fly  3273 RKLGKPPYLITLIMDCVCILFRRKVKPIRPDTEKAFIQSSWDESLKVMSDT-SFLRKIVEYPTDL 3336

  Fly  3305 IHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVK 3369
            |:.:::..:.||....:::.|.........|||.||.:.::::::|...|.|.:..|...|.:.:
  Fly  3337 INAEMVDMMVPYFQYPQYTFEAAKVACGNVAGLLSWTMAMSKYFEVNKEVLPLKANLAVQEAKYQ 3401

  Fly  3370 DARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRW 3434
            .|...|......|.:.|.:|..:|...::|::||....|||.|....:|.|..||||||.|||||
  Fly  3402 KASSDLQEAEELLQQKENELAEVQQTLEDAVSKKDAVLDEAKKCQDKMDAATALIGGLAGEKIRW 3466

  Fly  3435 MESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFE 3499
            .|.:........:|.||:::::.|:||.|.|.:.:|.:|| .:|....  .:..||.:..|:..|
  Fly  3467 TEQIASFKSETDRLVGDVILLTAFLSYTGPFNQEFRSDLQ-SIWTKQI--IEKMIPISANVNIIE 3528

  Fly  3500 MICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTG-LVVLRLSQ 3563
            .:.|.:||.|||.||||:|.:|.:|..|..::.|:||:||||.||..|:|.|.... ::|..|:.
  Fly  3529 SLTDRSQIGEWNIQGLPTDELSIQNGIISTKAMRFPLLIDPQSQGKVWIKNKEKQNKVIVTTLNH 3593

  Fly  3564 RNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGT--VLKIGDREIDFNSRFRLILH 3626
            :.:.:.:|.:||.|..::||::.|.:||.|:.||.|.|:|.||  .:||||:|:|:|..||..:.
  Fly  3594 KYFRNHLEDSVSMGIPIIIEDVAEELDPCLDNLLDRNLLKVGTQYKIKIGDKEVDWNPAFRCYIT 3658

  Fly  3627 TKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFL 3691
            |||.||.|.||:.|:|::|:||||..|||||||..|:..||.:||..|.:|.:........:|.|
  Fly  3659 TKLPNPAYTPEIFARTSIIDFTVTMRGLEDQLLGRVILAERKELEDERVQLVETVTGNMKKMKEL 3723

  Fly  3692 EDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASI 3756
            |.:||.:||:...::|:|||::..|..:|.||.|::.|:..||:|..:|::|||.||..|.|.|:
  Fly  3724 EANLLQKLSTTKGSLLDDVTVIEVLNTSKNTAIEVKEKIEIAKVTEAKINAAREEYRVVATRGSV 3788

  Fly  3757 IYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQ 3821
            :||::..:.::|.:||.||..|...|:.:|..:......:.|::.:|:.:||..:.|.||||:|:
  Fly  3789 LYFLVCSMARVNNMYQTSLVQFLERFDASMYNSSKTHITQKRIKRIINYLTFEIYRYKSRGLYEK 3853

  Fly  3822 DKLIFLTQLCIQILVNLGEVEPTELDFLLR---------FPYMPNQTSNFTWLTHVGWGGIRALN 3877
            ||.:|:..:.:.|...|..:...|....::         .|.:|     |.|.|...|..:..|.
  Fly  3854 DKFLFVLLMALSIDRQLELITFDEFQVFIKGGAALNLNDCPPVP-----FRWTTDETWLNLVQLT 3913

  Fly  3878 NQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFI 3942
            |...|..:...:.|:.:.|..:...::||||..|..:......:::.::|....||.....|.:|
  Fly  3914 NLTPFVNILSKVSGNERAWFTWYKKDAPENEIIPDGYNSLDPFRKMLLVRSWCMDRTISQCRKYI 3978

  Fly  3943 EEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLG 4007
            ...||.::.:...:.|.....||.....:...||.|.||..::|.|.|.     :....|.:|:|
  Fly  3979 ANSLGDRFAEPVVLNFEELLLESRELMPMICFLSLGSDPSSNIELLAKK-----NELKCHPISMG 4038

  Fly  4008 QGQEIVAENAIEIASQYGHWVILQNIHLVARWLPS-----LEKKMESSLSNVHTSYRLFLSAEPA 4067
            |||||.|...|....:.|.||:|||.||...::..     ||.:.:...:.|:.::|::::.|| 
  Fly  4039 QGQEIHARKLILSCLEDGGWVLLQNCHLGLEYMVELTVQILELERQGKDAAVNPNFRIWITTEP- 4102

  Fly  4068 GDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAV 4132
             .|.   .|..:|:..:|.|||||.|:.|.:.:...|.|.:.|:. |:...:..:::|:.:.|.|
  Fly  4103 -HPK---FPITLLQMCLKYTNEPPAGIRAGLKRTYTNLSQDFLDY-SQSPFYLPLVYSISFLHTV 4162

  Fly  4133 VAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL---EANTRVPWEDLRYLFGEIMYGGHITDDW 4194
            |.|||||||.|||..|.||..|...|...:.|:|   |....:.|..:||:.||:.|||.:|||:
  Fly  4163 VQERRKFGPLGWNIPYEFNSSDWYASCLFVQNHLDDIEQGKGISWVTVRYMLGEVQYGGRVTDDY 4227

  Fly  4195 DRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGF 4259
            |:||..|:...:....|.:...::.:|:......:...|...|||....:.|.:||.||||||.:
  Fly  4228 DKRLLNTFTRVWFHDTLFEDCFQFFKGYKVYSFKEQEAYLAAIDDMANVDPPQVYGFHSNAEITY 4292

  Fly  4260 LTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILEL------MGRV 4318
            .|.....:...:..:||:   .||.|...|:||.:...::::|.|||..|::.::      ||..
  Fly  4293 QTNTMRNILDEIMSIQPK---ESSAGTGESREDRVARQVKEMLSKTPLAFDLFDVKQHLIAMGAT 4354

  Fly  4319 EDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLA 4383
            ...:   |...||.:||..::..::....:|.|.::|.:.:|..:.|.:..::..:||..:.:.:
  Fly  4355 SSMN---IFLRQEIDRMQRIIILVRSIFKDLLLAVEGTIIMSENLRDALDNIFNARVPTVFKRGS 4416

  Fly  4384 Y-PSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNE-WPLDR 4446
            : .|.||.  ||::|:.|..:...|....| |...|::||||||..|||:.|:.||.:: |.||:
  Fly  4417 WVSSSLGF--WFTELLERHTQFYNWCFGAR-PVVFWMSGFFNPQGFLTAMRQEVARAHQGWALDQ 4478

  Fly  4447 MCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQD 4511
            :.::.||.|...||....|:||.::.|||::||.||.:...:.:|..|.||..|||::|.|:...
  Fly  4479 VTMHNDVLKVGPEECKKPPKEGVFVYGLFVDGAGWDKRTSRLVEATNKVLFTLMPVIHIYAIFST 4543

  Fly  4512 KQDIKNVYECPVY-KIRLRGPTFVWTFNLKSRERASKWTLAGVCLL 4556
            ......:|.|||| ||......::....|:|.:....|||.||.||
  Fly  4544 AAKNSKLYTCPVYKKINRTDLNYICALWLQSNKHPDHWTLRGVALL 4589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 132/669 (20%)
DHC_N2 1368..1770 CDD:285579 127/414 (31%)
P-loop_NTPase 1903..2132 CDD:304359 141/230 (61%)
P-loop_NTPase 2217..2352 CDD:304359 52/135 (39%)
P-loop_NTPase 2510..2783 CDD:304359 82/279 (29%)
P-loop_NTPase 2860..3127 CDD:304359 103/272 (38%)
MT 3140..3480 CDD:289543 95/351 (27%)
AAA_9 3509..3722 CDD:289547 93/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 210/702 (30%)
kl-3NP_001104482.3 DHC_N1 266..800 CDD:285571 123/628 (20%)
DHC_N2 1378..1778 CDD:285579 126/410 (31%)
P-loop_NTPase 1914..2145 CDD:304359 141/231 (61%)
P-loop_NTPase 2229..2364 CDD:304359 52/135 (39%)
P-loop_NTPase 2521..2790 CDD:304359 80/273 (29%)
P-loop_NTPase 2889..3151 CDD:304359 99/262 (38%)
MT 3164..3506 CDD:289543 93/346 (27%)
AAA_9 3538..3754 CDD:289547 93/216 (43%)
Dynein_heavy 3900..4582 CDD:281078 210/702 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93480803
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.