DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_016861618.1 Gene:DNAH1 HGNCID:2940 Length:4288 Species:Homo sapiens

Alignment Length:4481 Identity:1368/4482 (31%)
Similarity:2203/4482 (49%) Gaps:675/4482 (15%)


  Fly   425 LDKFLVRLEELKDLFNTVRDFQ-KLEKIVMGGLKG--RQITFALE----------KIL--EEYNS 474
            ||||..|:..    |....||| ::|:..:|....  .|..|.|:          ::|  :....
Human   129 LDKFTPRVGS----FEVPEDFQERMEQQCIGSTTRLLAQTDFPLQAYEPKMQVPFQVLPGQHPRK 189

  Fly   475 IYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLLRPI 539
            |..|....||  :..|.|..||.:...|.|    :|.|.:..|..:.:|..||          ||
Human   190 IEIERRKQQY--LSLDIEQLLFSQGIDSNK----LMPRHLDHQHPQTIEQGHD----------PI 238

  Fly   540 IKKHVEPLMHVIVDDFEEEIMC-VKKEFINFKNVFTALGLNE-------------LPTDDCFPKV 590
            ...:: ||.....:||:    | ..:|:||       :||..             |||||     
Human   239 FPIYL-PLKVFDNEDFD----CRTPREWIN-------MGLEPGSLDRKPVPGKALLPTDD----- 286

  Fly   591 SGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQ 655
                 ||            .||                          |..::.|..||   |..
Human   287 -----FL------------GHE--------------------------DPKSQKLKYKW---CEV 305

  Fly   656 GI---QQDITLTLIEK-DEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQA 716
            |:   .::..|.|:.| ||...:|......::.|          |...........|   :.|..
Human   306 GVLDYDEEKKLYLVHKTDEKGLVRDEMGRPILNA----------GVTTEGRPPLQVC---QYWVP 357

  Fly   717 RVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFI----------- 770
            |::|:..||                            .|.:       |:||.:           
Human   358 RIQLLFCAE----------------------------DPCM-------FAQRVVQANALRKNTEA 387

  Fly   771 VMIFKMVKYL-----HDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTD--PREPILS 828
            ::::.:  |:     ..:.|.::::|..||:    |.......||  .|::|.|..  .||..|.
Human   388 LLLYNL--YVDCMPSDGQHVISEQSLSKIKQ----WALSTPRMRK--GPSVLEHLSSLAREVSLD 444

  Fly   829 I-RAANAADTQRLI----DLLMYVNL--KLFFDIPRR--YSLPPGEHGEEDEESDGIWPPIISL- 883
            . |:.|..:...::    :...||.|  |....:|.|  .|:|.....|:.|:.     ..:|| 
Human   445 YERSMNKINFDHVVSSKPETFSYVTLPKKEEEQVPERGLVSVPKYHFWEQKEDF-----TFVSLL 504

  Fly   884 ---SVMTSVKFKKKREV------------IDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQ 933
               .|:|::. |.:.|.            :.:...|||||:.||::..: :..|.:...:..|..
Human   505 TRPEVITALS-KVRAECNKVTAMSLFHSSLSKYSHLEEFEQIQSQTFSQ-VQMFLKDSWISSLKV 567

  Fly   934 EERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEI-----FMELQEPNVVY 993
            ..|:..|:                 ::...|      |.||.|..::.:     .|||    |.|
Human   568 AMRSSLRD-----------------MSKGWY------NLYETNWEVYLMSKLRKLMEL----VKY 605

  Fly   994 -----FRNLDTSSKTGFAFFIE----TIL---DDM---NNMMSLLKRVAQDPTEVTNMNPYSFYD 1043
                 .|.|...|...|:.||.    ::|   |||   :::::...|..::|..:.::       
Human   606 MLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDL------- 663

  Fly  1044 ELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDA 1108
                  .||...|.....::.            .|.|.|.::||....:........|.::    
Human   664 ------VLDSSGVHYSTPLEQ------------FEASLLNLFDKGILATHAVPQLEKLVME---- 706

  Fly  1109 EADLEGSSGVKLLGLEYP------------------PLSVYKEQLDKFIELQDQIRTWETYEDFF 1155
            :..:.|...::.:||..|                  ||..|.::..|::||.:        .|..
Human   707 DIFISGDPLLESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNN--------NDIA 763

  Fly  1156 VFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVL----------KIEL 1210
            .||:...|   ..:|:|..:.:.|..|        ..||:.|....::|::          |..|
Human   764 SFLKTYQT---QGLLAQEVREVVLTHL--------REKEILDSSLPSSIIIGPFYINTDNVKQSL 817

  Fly  1211 QKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDT--ELAQINELPDAWMK 1273
            .|........:|.:|.:...|:  .||:.:..:.|...:    ||..::  |||::.|    |||
Human   818 SKKRKALATSVLDILAKNLHKE--VDSICEEFRSISRKI----YEKPNSIEELAELRE----WMK 872

  Fly  1274 --VKRLAATTKQLIAPIQSYQV-----------DLIEKRILLCDNMANTYRKKFL---------- 1315
              .:||....::::..:..|||           |..:|.|      |:.:..|.|          
Human   873 GIPERLVGLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWI------ASNWPSKILGQIELVQQQH 931

  Fly  1316 ---SKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCR-------- 1369
               .:||..:      :::|:::.: ..||..|..:|..::..|:.....:..|:.|        
Human   932 VEDEEKFRKI------QIMDQNNFQ-EKLEGLQLVVAGFSIHVEISRAHEIANEVRRVKKQLKDC 989

  Fly  1370 -------------FDL------KLVKIMWDFA--ITIQSTINDWKK-------TPWKKIDIENMD 1406
                         |.|      ||.:::.:|.  :.:.:|.:||.:       .|...||.|.::
Human   990 QQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLE 1054

  Fly  1407 QECKKFGRELRGLDKAMRTW-------EPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQ 1464
               |......:.:.|.::.:       |..:.:.|.::.....:..:..|:||.:|.|||..|..
Human  1055 ---KNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSN 1116

  Fly  1465 TTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDR 1529
            ...:......:.|....:::||.::.|.:..:.:.:.||.|:|:.|..:...|.|:.|....:..
Human  1117 QININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKA 1181

  Fly  1530 TSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQY 1594
            |...:||:.:|..:.|:||....|||:.|.|...||..:..|:|:|....:::..|...||.|.|
Human  1182 TDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLY 1246

  Fly  1595 LESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLL 1659
            ||.|| .||||..|||.:|:|:..:::.:|.::.....:|.|:...  |..::.:.|....|:|.
Human  1247 LEPIF-SSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVC--SDLRMLDSLRDCNKILD 1308

  Fly  1660 LCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAA 1724
            |.:|.|::||||||.::|||||:|..:||:|||...:|..|..||.|.::::.:| |........
Human  1309 LVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARL-LFQEDLEIT 1372

  Fly  1725 GMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQP 1789
            .|.:.|.|| |....:...|..||.||..:...|:.::.|.:::::..|...||..|:..||.|.
Human  1373 HMYSAEGEE-VQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQV 1436

  Fly  1790 ALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTID 1854
            .:.|.|..||.|..:|.     ...|.......:...||::|:.|:.|.|:..:|..:..:..|:
Human  1437 TIAGCQTYWTMEVAEAL-----EAGNLRSQLFPQLCQQLSDLVALVRGKLSRMQRAVLSALIVIE 1496

  Fly  1855 VHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPL 1919
            ||::|||..:|.:.|.....|||.||||:.|..  :|.:....:|:|.|.||||||:.|||||||
Human  1497 VHAKDVVSKLIQENVVSVNDFQWISQLRYYWTN--NDLYIRAVNAEFIYGYEYLGNSGRLVITPL 1559

  Fly  1920 TDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLA 1984
            |||||:|||.:|||..||||||||||||||||||||:||.:...|||||:|:|:.::|...||||
Human  1560 TDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLA 1624

  Fly  1985 QTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAG 2049
            ..|||.||||||||.:|||||||.|:..||.|.:.:.:.|.|.|..|.|..:..|||||||||||
Human  1625 SAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAG 1689

  Fly  2050 RAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWG 2114
            |.|||:|||||:||.||:|||:|:|:||.|.:.||.||.:||:|..|.:.|..|.||.|||||:|
Human  1690 RTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFG 1754

  Fly  2115 LRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRN 2179
            :||:|:|:..||.|:|::....|:.:.:||:||.|:||.:.:|:.:|.|::.||||.:   ::.:
Human  1755 MRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTI---KEED 1816

  Fly  2180 PEF---EAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQN 2241
            .::   :..|:.:..:..|:..:||:.|.:||.|...|||.:.::|..|:|||..::.|.....:
Human  1817 TDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTS 1881

  Fly  2242 QKRKP----------HYNDLNPKAVTNDELFGIVNPSTREWK----------------------- 2273
            .|.:|          :|..||||::|..:|:|..:..|.||:                       
Human  1882 LKGQPSISGGMYEAVNYYVLNPKSITMGQLYGEFDLLTHEWRRFRSLRLDQAQHLHQPYQPLPWT 1946

  Fly  2274 DGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFE 2338
            ||:||..:|..|....|..||.:.||.:|.:|||::|||:||||.|.|:|.|.|.||:.|.::||
Human  1947 DGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFE 2011

  Fly  2339 IASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTR 2403
            :..|..|:||||||.|::|:.|..||..|||:.||                 :.:||||..:...
Human  2012 VQDLAVASPATVSRCGMVYLEPSILGLMPFIECWL-----------------RKLPPLLKPYEEH 2059

  Fly  2404 LRSI-------------TPISDI-----ARLQMTCY-LLDSMLTP-------QNVPNDCPK---D 2439
            .:::             :.:.::     ..|.|:.. |||....|       :.:|::...   :
Human  2060 FKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRIVE 2124

  Fly  2440 WYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFL----NEYKAVKFPLSGTIFSFYI------- 2493
            ..|.:|:|.::|..|::  .|.  .....||.|..    ||...:.||..|.:|.:.:       
Human  2125 LIEPWFIFSLIWSVGAT--GDS--SGRTSFSHWLRLKMENEQLTLLFPEEGLVFDYRLEDAGISG 2185

  Fly  2494 -------DHETKK--FFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIG 2549
                   :.|.|:  :..|.:....|.:..|....:.:|.|.:|.::...:|.|:....|::.||
Human  2186 TNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIG 2250

  Fly  2550 PSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYF 2614
            |:|:|||:.::.||....:..|....:.|:..|::...|..::..|:|:....:||...:..|:|
Human  2251 PTGTGKTLTISDKLLKNLALDYISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFF 2315

  Fly  2615 VDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKM-TLRDIHKCNIVACMN-PSAGSFTIDPRL 2677
            :||:|||.::.|....|..|:||:||:..||||:.: ..:::...|.|..|. |..|..|:.|||
Human  2316 IDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRL 2380

  Fly  2678 QRHF--CSFA-VNPPSQDALFHILNSILSQHMDNPI------QKFDKA--VIKLCENMVTTAITL 2731
            .|||  .||| ::..|:..:|   ::||...:|..:      ::...|  :....|.:|...|.:
Human  2381 MRHFNYLSFAEMDEVSKKRIF---STILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMV 2442

  Fly  2732 HLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYT 2796
            :..:.|..|||..|.||.|||||::.:|.|:|.::.....:..|::|||.||..||:.|:||:..
Human  2443 YATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEE 2507

  Fly  2797 DINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIK-YMPISGWDRLKSLLDEAQDRY 2860
            |.:.|.:::...:.:. |...:.|...||::|..|....:|:| |..|:...::..:::|..:.|
Human  2508 DRSWFDQLLKRCMEQW-EVTFNKVCPFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYIEDY 2571

  Fly  2861 NDYIGA-MNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLT 2924
            |....| :.||||.|||||:|||||.|..:.|.|||:||||||:.|||||||.::..:.|||:|:
Human  2572 NQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELS 2636

  Fly  2925 KDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENI 2989
            |:|.:|:.:.::..:.:|||::.....||.:|:::..|.||..:|::|.||||..|:..||.:.|
Human  2637 KNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQI 2701

  Fly  2990 VNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFH 3054
            |:.:|..:::.|:...:.|....:..:|||.:.:|||.||:|...|.|.|:||:||||.|||||:
Human  2702 VSTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFN 2766

  Fly  3055 EWPQQALESVSLRFLSEITVL--PKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFL 3117
            |||.:||:||:..||:||..|  .:|....:.....::|::|:.....|||...|:||.||||:|
Human  2767 EWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYL 2831

  Fly  3118 ELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIV 3182
            ||:.::|.|:.:|.......:.|:::||.||...:::|..:|:.|  :.:...::....|.::.:
Human  2832 ELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDL--ESMHPLLEEAAKDTMLTM 2894

  Fly  3183 VGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKL-------CEEDFLKAQPALIAAQEALNTLN 3240
                 |::..:.|.|.:...:|:..|.....|||.       .::|..:|.|||.||..:|..||
Human  2895 -----EQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLN 2954

  Fly  3241 KNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPK-----------DRSWKACRAFMGNVDKFL 3294
            ||::||:::...||..|..|..||.::   ||..||           |..|:..:..:.:...||
Human  2955 KNDVTEVRAMQRPPPGVKLVIEAVCIM---KGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFL 3016

  Fly  3295 DNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKER 3359
            ::|..:||.:|...||||:||||.:.||.|..|...|.|...:|.||..:::::.|...||||.:
Human  3017 ESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQ 3081

  Fly  3360 ALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLI 3424
            ||||::.::...:..|.....||.|:|:.:..:|.:|.|.:.||::.:.:..:....:..|.:||
Human  3082 ALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLI 3146

  Fly  3425 GGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKN----- 3484
            .||:.||:||.|:|:.|.:.:..:.||:|:.:.|::|:|.||..||..|.:. |:...::     
Human  3147 NGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDS-WVKQLRSHNVPH 3210

  Fly  3485 -SQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWV 3548
             |:|.:..|.|        :..:|..|...|||:|.:|.||..|...|:|:...||||.|..||:
Human  3211 TSEPTLIGTLG--------NPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWI 3267

  Fly  3549 KT-KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKK--GTVLKI 3610
            |. :...||.|.:||.|::|..:|.|:..|...|:||:||.:||.|.|:|.:|..|:  .||||:
Human  3268 KNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKL 3332

  Fly  3611 GDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRT 3675
            ||..|.::..||:.:.|||.||||.||:..:.||||||::..|||||||.:||..||||||..:.
Human  3333 GDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKN 3397

  Fly  3676 RLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQI 3740
            :|.......:..||.:||.:|.||||:..|.::|:.|:..||.:|..|.||:.||..|:.|...|
Human  3398 QLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDI 3462

  Fly  3741 DSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDS 3805
            |..|..|.|.|.|..|::|.::||..::|:||:||:.|..:|.:.:..:..|:.||.|:.|:...
Human  3463 DLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRY 3527

  Fly  3806 ITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFT--WLTHV 3868
            :|:..:....|.|||:.||:|...||::|::|.|::..:|..:||....:...|.|..  ||:..
Human  3528 LTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGGSISIMTENPAPDWLSDR 3592

  Fly  3869 GWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEW-KGKSAIQRLCIMRCIRPD 3932
            .|..|.||:|...|.....|.......::...||..|..|..||.| :.....|:|.::||:|.|
Human  3593 AWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEPHREPLPGIWDQYLDQFQKLLVLRCLRGD 3657

  Fly  3933 RMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFD 3997
            :::.||:.|:...|..::|:.::...|..|::|:..|.:.||||||.||..|:.|..:.:.||  
Human  3658 KVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFS-- 3720

  Fly  3998 HENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLF 4061
             :...::||||||...||..:..:.:.|.||..||.||...|:|:||:.:|. :...||..:||:
Human  3721 -KKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLW 3784

  Fly  4062 LSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSL 4126
            |::.|:..     .|..||::..|:|.|||.|:.||:.|:..:..::.|..|.|..|||::|.||
Human  3785 LTSLPSNK-----FPVSILQNGSKMTIEPPRGVRANLLKSYSSLGEDFLNSCHKVMEFKSLLLSL 3844

  Fly  4127 CYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHIT 4191
            |.||....|||||||.|:|..|.|..|||.|.:..|..:|:....:|::.|:|..|||.|||.:|
Human  3845 CLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVT 3909

  Fly  4192 DDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYT-------GYHNYIDDNLP-SESPSL 4248
            ||||||.....||:|..|:::..|..|    .|.||....       ||.:|| .:|| ::.|.:
Human  3910 DDWDRRCIMNILEDFYNPDVLSPEHSY----SASGIYHQIPPTYDLHGYLSYI-KSLPLNDMPEI 3969

  Fly  4249 YGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILE 4313
            :|||.||.|.|....:..|...:.:|||:.:...|.|    :|:|::::.::||.|.|.|.|:..
Human  3970 FGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQG----REEIVEDVTQNILLKVPEPINLQW 4030

  Fly  4314 LMGR----VEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQ 4374
            :|.:    .|:....::|  ||..|.|.|:..:.::|.:|...|||.:.:||.:|.:...||.:.
Human  4031 VMAKYPVLYEESMNTVLV--QEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNT 4093

  Fly  4375 VPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARK 4439
            |||.|:..||||:..|.||..||:.||..|:.|:.| .:|:..|::|||.||:.||..:|..|||
Human  4094 VPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQD-GIPAVFWISGFFFPQAFLTGTLQNFARK 4157

  Fly  4440 NEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLY 4504
            ....:|.:..:..|..:...|||..|:.|.||:|||:||||||.:...:|::..|||:..|.|::
Human  4158 FVISIDTISFDFKVMFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIW 4222

  Fly  4505 IKAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLL 4556
            :......|...::.|.||:||...|..|         :|....:.:.:....|...||.|:
Human  4223 LLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALI 4283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 73/371 (20%)
DHC_N2 1368..1770 CDD:285579 118/445 (27%)
P-loop_NTPase 1903..2132 CDD:304359 144/229 (63%)
P-loop_NTPase 2217..2352 CDD:304359 58/168 (35%)
P-loop_NTPase 2510..2783 CDD:304359 87/286 (30%)
P-loop_NTPase 2860..3127 CDD:304359 118/270 (44%)
MT 3140..3480 CDD:289543 109/358 (30%)
AAA_9 3509..3722 CDD:289547 96/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 246/708 (35%)
DNAH1XP_016861618.1 DHC_N2 1016..1417 CDD:285579 113/409 (28%)
P-loop_NTPase 1543..1773 CDD:304359 144/230 (63%)
P-loop_NTPase 1857..2026 CDD:304359 59/169 (35%)
P-loop_NTPase 2211..2494 CDD:304359 87/286 (30%)
P-loop_NTPase 2571..2841 CDD:304359 118/270 (44%)
MT 2854..3203 CDD:289543 109/360 (30%)
AAA_9 3229..3444 CDD:289547 96/215 (45%)
Dynein_heavy 3583..4276 CDD:281078 247/713 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.