DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah12

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_006252733.1 Gene:Dnah12 RGDID:619990 Length:3960 Species:Rattus norvegicus

Alignment Length:4063 Identity:1284/4064 (32%)
Similarity:2063/4064 (51%) Gaps:455/4064 (11%)


  Fly   736 PTEKRLIAAEMILIEEQMKP---------------LLDFIKWNAFSQRFI---VMIFKMVKYLHD 782
            |.:.:.:...::||.|.:|.               .:||.|   ..:|::   |::...||:|.|
  Rat   110 PIQPQWLDHMLMLIPEHLKEGKKREELLGSLINEVSMDFEK---SMKRYLVQSVLVKPPVKWLED 171

  Fly   783 RLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDP--------REPILSIRAANAADTQR 839
                             .||.:|      .:|..|.:::|        |..||    ||......
  Rat   172 -----------------EWGPLP------ESPEGLDYSNPWHSNFVQARSQIL----ANLHIVHP 209

  Fly   840 LIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDL 904
            .:.||:.:....|.||                             ::..:...:.|..||.|...
  Rat   210 TMKLLLELGYTTFSDI-----------------------------ILLDLTGIRDRGPIDCEALR 245

  Fly   905 EEFEEEQSESEE--------EIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVI-- 959
            .:...:..::||        ::|..|.:.|.|:|:..|:...|  |...  .|:..|.:..::  
  Rat   246 NDLSIQARKAEERIMNTWYPKVINLFTKKEALEGIKPEKVDSF--YNCV--SILMSNQLKDLLWR 306

  Fly   960 TSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLK 1024
            |...::|: .|:||....|||::.:...:..:.::.....             |:|:  ::.|::
  Rat   307 TVEEFVRL-FDSRYILRLPIFKMELTFDDDKMEFYPTFQD-------------LEDV--VLGLIE 355

  Fly  1025 RVAQDPTEVTNMNPYSFYDELQDKSELDKQRVE-----IMNKIKLA----LQAVRVHGKGFMEFS 1080
            |:::  |..|.....|:.........||.:..|     .::.:::|    |:.||.|.|.::. :
  Rat   356 RISE--TLQTVQTVPSWLSGTTAPVNLDTELPEHVMYWALSTLRIAVHQNLEGVRAHYKTYVT-N 417

  Fly  1081 SLWIWDKSTYLSEVKKF-GRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQ 1144
            ..|:.| .|....:::| ..|.|.||                         |.|.:::|..|..:
  Rat   418 YNWLLD-GTATKMIERFQSENHTFDE-------------------------YTEFIERFFSLASE 456

  Fly  1145 IR---TWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVL 1206
            |.   .|..|.    .:||:....|..:.::...:.::...|:.::.:   ||.:....|...:.
  Rat   457 IMLLPQWAHYP----MVRLDCEDLKTGLTNKAKAFANILLNDIASKHR---KENESICSEFETIK 514

  Fly  1207 KIELQ-KDDFEGLVKILSVLNQI------NEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQI 1264
            :..|: .:..|.::::::.:.:.      |..|.|.:|.           ||..| |.||.|...
  Rat   515 EHALRVPETTEEMMELIAFIEKARTTGIQNLAQRIQESK-----------RQMGY-FLDTFLLSQ 567

  Fly  1265 NELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYE 1329
            .:|.   :....|...:|  |.|:.....:|||       |...|...:.::|:...:     .|
  Rat   568 EDLN---LNASVLLWPSK--INPVFDENDELIE-------NSKRTKENELIAKREKLI-----LE 615

  Fly  1330 LIDESD-----LELVALEERQRSLA------------ESAVLFELQGPDPVKIELCRF-DLKLVK 1376
            :..||.     .|...|:..|:.:|            |.||.|..:..:..|.||.:: :|:.:|
  Rat   616 IEKESRRMEEFTEFAELDRMQQYVADVRHLQKRIQDSEEAVQFINKEEELFKWELTKYPELEKLK 680

  Fly  1377 I-------MWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWE------- 1427
            :       .::|.:..|.|...|....:..::.|:|:.:..:|.||:....|..:|.:       
  Rat   681 VTIEPYQKFFNFVLKWQRTEKRWMDGGFLDLNGESMEADIDEFSREVFKTLKFFQTKQKKELQEK 745

  Fly  1428 ---------------------PFIFMEAS----LKNLMTSLRAVTELQNPAIRDRHWIELMQTTK 1467
                                 |.|.|.|:    :|.....:..|:.|.||.:|.|||.::.:...
  Rat   746 RKAARKRSLMEEKPEEEPKESPTITMCATVMEQIKVFKEYIPTVSILCNPGMRARHWKQMSEIVG 810

  Fly  1468 VKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSI 1532
            ...:.|..|||:.::.|||..|.|..:.|...:.||.::|:.:..:...|..:.|...::..|.:
  Rat   811 YDLTPDSGTTLRKVLKLNLTPYLESFEVISAGASKEFSLERAMNAMIATWDDISFHISLYRDTGV 875

  Fly  1533 KLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLES 1597
            .:|.:.:|:...|:|...:.|.|..|.:|..||:|::.|::||....:.|..|.:||.:|.|||.
  Rat   876 YILSSVDEIQAILDDQIIKTQTMRGSPFIKPFENEIKAWEDRLIRIQETIDEWLKVQAQWLYLEP 940

  Fly  1598 IFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG--SKLYEHLEILLKMLLL 1660
            ||. ||||..|:||:.|:|..:|:.:|.::.....|..|:.:|:.:|  .||....::|.|::  
  Rat   941 IFC-SEDIMQQMPEEGRQFQTVDRHWKDIMKFCAKDPKVLAATSLTGLLEKLQNCNDLLDKIM-- 1002

  Fly  1661 CEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAG 1725
              |.||.|||.|||.:|||:|:|:.::|:|||...:|..|..||.|.::.:.||..:: :.:...
  Rat  1003 --KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLT-NLDIKA 1064

  Fly  1726 MVAKELE--EYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQ 1788
            |.:.|.|  |.:..:......|.||.||.::.|.|..::.|.:..|...|....|..|:.|||.|
  Rat  1065 MYSSEGERVELISVISTSAARGAVEKWLIQVEDLMLRSIHDVIAASRLAYPESARKDWVREWPGQ 1129

  Fly  1789 PALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTI 1853
            ..|..:|:.||:||.:..:...:    .||.|.|:...|||:::.|:.|.|:...|..:..:.||
  Rat  1130 VVLCVSQMFWTSETQEVISGGNE----GLKKYYKELQYQLNDIVELVRGKLSKQTRITLGALVTI 1190

  Fly  1854 DVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITP 1918
            |||:||||..:|...|...|.|||.:|||:.|:  .::....|.:...:|.||||||:|||||||
  Rat  1191 DVHARDVVMDMIDMGVSHDTDFQWLAQLRYYWE--YENARVRIVNCNVKYAYEYLGNSPRLVITP 1253

  Fly  1919 LTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGL 1983
            ||||||.||..:.:|.:||||.||||||||||||||.:||.:...|||||:.:||.::|...|||
  Rat  1254 LTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGL 1318

  Fly  1984 AQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYA 2048
            |.:|||.||||||||.:|||||||.|:.|||.||:.|.:.|.|.|..:.|.....|.||||||||
  Rat  1319 ASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLEVFVFEGTELRLNPNCFVAITMNPGYA 1383

  Fly  2049 GRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDW 2113
            ||:|||:|||.|:|..||:||::|||:||.|.:.||..|:.|:.|.:..|.||.|.||.|.|||:
  Rat  1384 GRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDY 1448

  Fly  2114 GLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKR 2178
            |:||:|:|||.||.|:.......||.:|:|:::|.|.||.::.|:|:|.|:..||||.:.:|...
  Rat  1449 GMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEAD 1513

  Fly  2179 NPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTL-------N 2236
            ..||......:.....|||...|:.||:|..|:..|||...::|.....|:||...|       |
  Rat  1514 YQEFLECAYEACETQNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTEVLHILADTLTLMN 1578

  Fly  2237 KTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDI 2301
            :.....:.|..|..:|||::|..:|||..:|.:.||.||:.:...|:.|.......||:|.||.|
  Rat  1579 ERNYGDEEKVMYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALAESPDRKWVVFDGPI 1643

  Fly  2302 DPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWT 2366
            |.:||||:|||:||||.|.|.|.|.|.::.:|.|:||...|..|:||||||.|::|:.|..|||.
  Rat  1644 DTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWE 1708

  Fly  2367 PFIQSWLGT---RTNSSE-VSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSML 2427
            |.:.|||.:   ..|..| .::|..||:..|.|.|:..|.:.:.:.|..:|..:.....|::.:|
  Rat  1709 PIVASWLNSLKEPLNELEHQNLLKELFNWLVQPSLEFRRKKCKELIPTGNINAVVALTRLIEILL 1773

  Fly  2428 TPQNVPNDCPKD-----WYEIYFVFCIVWGFGSSL----------FQDQIIDWSNEFSKW--FLN 2475
            ... |.|| |..     |....|||.::|..|:|.          |...::...|:.:..  |:|
  Rat  1774 CTV-VEND-PSSKHIRVWIMATFVFSLIWSVGASCDTDGRLAFDNFLRSLVTGKNDKAPMPVFIN 1836

  Fly  2476 EYKAVKFPLSGTIFSFYIDHETK-KFFPWTNLVPQFEL-DMDLPLQSNLVNTAETTRLRFFMDTL 2538
            :::. .|...|.::.:..:...: ::..|.:|:...:: |....:|..:|.|.:|.|..|.||..
  Rat  1837 KWEC-PFDEKGLVYDYMYELRNRGRWIHWNDLIKSSDIEDRRTKIQDIIVPTMDTIRYTFLMDLC 1900

  Fly  2539 IEADHPLMLIGPSGSGKTILMNAKL-SALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRN 2602
            |....||:.:||:|:||::.:..|| :.|...||....|.|:..|::..:|.|:...|:|:....
  Rat  1901 ISHAKPLLFVGPTGTGKSVYVKDKLMNHLEKGKYFPFYVNFSARTSANQVQNIIMARLDKRRKGV 1965

  Fly  2603 YGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQ---KMTLRDIHKCNIVACM 2664
            :||...|:.:.|:||||||.::||....|..|:|||.|..||||.:   |:||.||   .::|.|
  Rat  1966 FGPPMGKKCVVFIDDMNMPSLEKYGAQPPIELLRQFFDCGHWYDLKDTTKITLVDI---ELIAAM 2027

  Fly  2665 N-PSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTA 2728
            . |..|...:.||..|||....:|..|.:.:..|.:||:..::..  ..|......|...:|:..
  Rat  2028 GPPGGGRNAVTPRFIRHFNICTINSFSDETMVRIFSSIMMFYLRT--HDFSPEYFVLGHQIVSAT 2090

  Fly  2729 ITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLV 2793
            :.::.:.:.:.|||..|.||.|||||.:.:..|.|..:.|...:.:.||||::||..||:.|:|:
  Rat  2091 MEIYKQSMGNLLPTPAKSHYTFNLRDFSRVIRGCLLIDKEAIESKHTMIRLFVHEVLRVFYDRLI 2155

  Fly  2794 DYTDIN----SFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIK-----------YM-- 2841
            :..|.|    ..|.::.|..::.:|.|           :.|..:|.:.|.           ||  
  Rat  2156 NDEDRNWLFLLIKNVIKDHFKESLENV-----------FSHLRRGNSSINEEDLRNLMFGDYMNP 2209

  Fly  2842 PISGWDRL----------KSLLDEAQDRYND-YIGAMNLVLFDDAMSHVCRISRILESSRGYALL 2895
            .:.|.||:          ..::|:..|.||. :...||||:|...:.|:.||.|||:.|.|.|||
  Rat  2210 DLEGDDRVYIEILNIHQFNEVVDQCLDEYNQTHKRRMNLVVFRYVLEHLSRICRILKQSGGNALL 2274

  Fly  2896 IGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVA 2960
            ||:||||:||||.||:.::.:.:||.:::|.|.:::.:.:|.:|....|||.....||:||:::.
  Rat  2275 IGLGGSGRQSLTSLATSMAKMQIFQPEISKSYGMNEWREDIKSLLRNVGVKGQKTVFLITDTQIK 2339

  Fly  2961 REQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNREN------CWKYFIEKVRS 3019
            .|.||..::.:|.:|::..:|..||.:.::..|| .|.|:|   |:..      .:.:|:.:.:.
  Rat  2340 EEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVR-PVAQVG---NKHGELSPLALFAFFVNRCKD 2400

  Fly  3020 LLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLS--EITVLPKELALP 3082
            .|.||:.|||:|...|.|.|:||:|:||.|||||..||:.|||.|::.||.  |:|.:.:...:|
  Rat  2401 NLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVSFLETVELTEVERHEIVP 2465

  Fly  3083 VSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIK 3147
            :....   |.::.::|:.:|....|:||.|..|:||||..:.:||.:|.::.::.:.|..|||.:
  Rat  2466 ICKHF---HTSIMNLSERFLEELGRHNYVTATSYLELIGSFRQLLTKKRQSVMEAKQRYVNGLDQ 2527

  Fly  3148 LASCTKEVDALQDVLKVQEVELKIKNQEADN--LIIVVGTENEKVSKERAFASKEEKNVRQIEED 3210
            ||....:|..::  |::.|::.|::..:.:|  ::.::..|:.:|..:|.....:|:......|:
  Rat  2528 LAFAESQVGEMK--LELVELQPKLEAAKVENARMMQIIEIESAQVEAKRKIVKLDEEIASGKAEE 2590

  Fly  3211 VTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIP 3275
            ..|....||.|..:|.|||.||..||:||...::|.:||..:||..|..|..||.|:...|.:..
  Rat  2591 AQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPAGVKLVMAAVCVMKDIKPEKI 2655

  Fly  3276 KDRS---------WKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQ-PYILDAEFSPEKILAK 3330
            .|.|         |...:..:|::: ||.:|..|||::|...|::.:: .|:.:.||.|.|:...
  Rat  2656 SDPSGTGGKIFDYWGPSKKLLGDMN-FLRDLREYDKENIPVAVMQKIRSEYLTNPEFDPPKVAKA 2719

  Fly  3331 SSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQME 3395
            ||||.|||.|::.:..:..|..||.||:..|.|::|.:.:..:.|......|.::|..|..||..
  Rat  2720 SSAAEGLCKWIMAMEVYDRVAKVVAPKKARLAEAQKSLAETMELLNQKRGELAQVEHHLENLQKT 2784

  Fly  3396 YDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFIS 3460
            :.|...:|...:|:....|..::.|.:|||||..||.||.::...|....:.|.||:|:.:..|:
  Rat  2785 FQEKTEEKAALEDQVELCAKKLERATKLIGGLGGEKSRWSQAANDLQATYENLTGDVLVSAGVIA 2849

  Fly  3461 YVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENA 3525
            |:|.||..:|||..|. |....|..:  .|.::.....:.:.|..:|..||..|||:|..|.:|.
  Rat  2850 YLGAFTSGFRQECTED-WSKLCKEKK--FPCSEEFSLSKTLGDPVKIRAWNIAGLPTDTFSIDNG 2911

  Fly  3526 AILVQSERYPLMIDPQLQGIKWVK-TKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENI 3589
            .|:..|.|:|||||||.|..||:| ::....|.|::||..:|:..:|..:..|:.:|:||:||::
  Rat  2912 VIVNNSRRWPLMIDPQGQANKWIKNSEKDNQLSVIKLSDSDYMRTLENCIQLGTPVLLENVGEDL 2976

  Fly  3590 DPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRD 3652
            ||.|.|||.||..|:|.:  :::|:..|:::..|:..:.|||.||||.||:..:.:|:||.:|.:
  Rat  2977 DPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPE 3041

  Fly  3653 GLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLE 3717
            |||||||..||..|||:||..|..|..|....|..||.:|..:|..||.:..|:|||.:.:..|:
  Rat  3042 GLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIETRILETLSCSEGNILEDESAIKVLD 3106

  Fly  3718 KTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVF 3782
            ..|..::||..|...|:.|.::|..:||.|||.|:.:|:::|.:.||..|:|:||:||..|..::
  Rat  3107 SAKMMSNEITKKQQVAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLY 3171

  Fly  3783 NNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELD 3847
            .|::..:..::.|:.|:..|.|..|:..:....|.|||:|||:|...||..:|:...|:|..||.
  Rat  3172 INSIHDSNRSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLAKKEIEYQELM 3236

  Fly  3848 FLL----------RFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDS 3902
            |||          :.| .||      ||....|..|...:...||.||.:......:.|:...:|
  Rat  3237 FLLTGGVSLKSAEKNP-DPN------WLQDKSWEEICRASELPVFHGLREHFCNHIREWEDIYNS 3294

  Fly  3903 ESPENEKFPGEW-KGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESS 3966
            :.|.|.|.|... |..:.:|::.|:||:|||:::.|:.:::.:|||.|:::....:.::::.:|:
  Rat  3295 KEPHNMKLPESMDKTLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSN 3359

  Fly  3967 PETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQ 4031
            ....:.||||||.||:..:.|.....  |.....|.::||||||..||...|..|.:.|.||.||
  Rat  3360 CTIPLIFVLSPGADPMASLLKFANDK--SMSGNKFQAISLGQGQGPVATKMITAAIEEGTWVCLQ 3422

  Fly  4032 NIHLVARWLPSLEKKMESSLSNV-HTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMM 4095
            |.||...|:|:|||..|.....: :.::||:|::.|:..     .|..||::.:|:|||||||:.
  Rat  3423 NCHLAVSWMPTLEKICEDFSPEICNPTFRLWLTSYPSPK-----FPVTILQNGVKMTNEPPTGLR 3482

  Fly  4096 ANIHKAL--DNFSD-ETLEMC-SKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLT 4156
            .|:.::.  |..|| |....| .||..::.:||.:|:|||:|.||:||||.|||..|.||..||.
  Rat  3483 LNLLQSYLSDPISDPEFFNGCPGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLR 3547

  Fly  4157 ISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDG---ELEY 4218
            ||:..|..::.....:|:|.:.||.||..|||.:||||||||..|.|.:|....:|:.   :...
  Rat  3548 ISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNSLIIENPHYKFSP 3612

  Fly  4219 CQGFPAPGILKYTGYHNYIDDNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQ--PRMTG 4280
            ...:.||....|..|..:| ..|| ::.|.::|||.|.:|......::.||..:...|  .:.| 
  Rat  3613 SGNYFAPPKGTYDEYIEFI-KKLPFTQEPEIFGLHENVDISKDLQQTKLLFESLLLTQGGVKQT- 3675

  Fly  4281 GSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMG----RVEDRSPYIIVAFQECERMNNLMTE 4341
            ||||    |.:.|:..|.||||.:.|..|:|...:.    |.|:....::|  ||.||.|||:..
  Rat  3676 GSSG----STDQILLEITEDILTQLPNDFDIEAALRSYPVRYEESMNTVLV--QEMERFNNLIIT 3734

  Fly  4342 LKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEG 4406
            ::.:|.:|...:||.:.:.|.:|.|...|.:.:|||.|.:.:|||:..|.|:.:|.:.||:.||.
  Rat  3735 IRNTLRDLKKAIKGVVVMDSALEALSGSLLIGKVPEMWAQRSYPSLKPLGSYITDFLTRLKFLED 3799

  Fly  4407 WVADFRM--PSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGA 4469
            |   |.|  |:..|::|||..|:.||..||..|||...|:|.:....:|..  .:..|..|.:|.
  Rat  3800 W---FTMGKPNVFWISGFFFTQAFLTGAMQNYARKYTIPIDLLGYEFEVIP--SDNATNPPEDGV 3859

  Fly  4470 YINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPT-- 4532
            ||:||:::||||:...|.:|:...|.||..||:::||...:.:....:.|.||:||...|..|  
  Rat  3860 YIHGLYLDGARWNRTSGLLAEQHPKLLFDLMPIIWIKPNVKTEIVKTDAYVCPLYKTSERKGTLS 3924

  Fly  4533 -------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
                   ||....|::...|..|...||.||.|
  Rat  3925 TTGHSTNFVIAMLLRTELPAQHWIKRGVALLCQ 3957

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 8/42 (19%)
DHC_N2 1368..1770 CDD:285579 123/446 (28%)
P-loop_NTPase 1903..2132 CDD:304359 138/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 56/142 (39%)
P-loop_NTPase 2510..2783 CDD:304359 92/279 (33%)
P-loop_NTPase 2860..3127 CDD:304359 102/276 (37%)
MT 3140..3480 CDD:289543 109/352 (31%)
AAA_9 3509..3722 CDD:289547 90/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 245/712 (34%)
Dnah12XP_006252733.1 DHC_N2 679..1110 CDD:285579 121/437 (28%)
P-loop_NTPase 1238..1468 CDD:304359 138/230 (60%)
P-loop_NTPase 1552..1695 CDD:304359 57/143 (40%)
P-loop_NTPase 1875..2145 CDD:304359 92/275 (33%)
P-loop_NTPase 2246..2507 CDD:304359 100/268 (37%)
MT 2519..2864 CDD:289543 107/348 (31%)
AAA_9 2896..3110 CDD:289547 90/214 (42%)
Dynein_heavy 3251..3948 CDD:281078 248/724 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.