DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah7

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_008756271.1 Gene:Dnah7 RGDID:621798 Length:4039 Species:Rattus norvegicus

Alignment Length:4390 Identity:1316/4391 (30%)
Similarity:2089/4391 (48%) Gaps:672/4391 (15%)


  Fly   410 NSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQK------------LEKIVMGGLKGRQIT 462
            |.|.:..:. |.||:..|.|.::::.:...:|.|...|            |..::|      |..
  Rat    78 NEQSYAEYM-EHFGKKGKLLDQIDDTRSAPSTSRSKVKSPHKERENFRSTLVNVIM------QQD 135

  Fly   463 FALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHD 527
            .:||..:.:.:.|             |.|..|..::|.|.:           .:....|::..:.
  Rat   136 SSLEPDVTDESGI-------------PKATTSAIEKDILRY-----------YYYIHHGIDTDNV 176

  Fly   528 LLLAGSLL--LRPIIKKHVEPLMH---VIVDDFEEE-IMCVKKEFINF-------KNVFTALGLN 579
            ..:..|.|  :..::.:|::.|.:   |:.|:..|: ::.|||..::|       |...|.  :.
  Rat   177 APMEDSWLEHVLQLVPQHLKVLTNSITVLSDEMREDYLLSVKKSIVDFVLKDPREKEDDTK--IT 239

  Fly   580 ELPTD----DCFPK-----VSGAISFLK--------------KLRHRIIGLHKEHELYEYPLFDN 621
            |||..    :..||     ...|.|:::              .|.|   ...|:..|.:...|.|
  Rat   240 ELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPTMLAVLDLWH---STFKKLRLVDIEEFHN 301

  Fly   622 ERGGY-VSDIFNIMVQEIDDFTKMLLDKWTVEC----WQGIQQDITLTLIEKDEANELRVNF--- 678
            .:... :|...||:::.::...:.||..|..|.    :||.::.   .|...|.:.:|...|   
  Rat   302 RQDALELSGFQNIVIKHMESAKETLLKTWFPEVQNIYYQGNKKK---QLPTGDSSAKLESFFNCA 363

  Fly   679 TERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHP------- 736
            ...:...|:|:.:|.:      .:.|....:..|..:|              ||  ||       
  Rat   364 ATLMTLQLQDLILVSM------QDFTDLIAQPPESIRA--------------FE--HPGFIMRLV 406

  Fly   737 TEKRLIAAE---------MILIEEQMKPLLDFI---------KWNAFSQRFIVMIFKMVKYLHDR 783
            .:|:.:..|         ::.:.|.|...:.|:         ||.:.|:...:           :
  Rat   407 LDKKAVKFEPEFTDYIDILVNVYEIMIKAVSFVPRVETKLYSKWESKSKPTTL-----------K 460

  Fly   784 LVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVN 848
            .:...|.::|.||.||                                                 
  Rat   461 PIILDEIIDAHKEKIR------------------------------------------------- 476

  Fly   849 LKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSE 913
                 ::..|.|:.|.||                |.:....:|...|:.   |.|:||| ..||:
  Rat   477 -----EVVLRESVAPTEH----------------LKMYDKYQFLITRQA---EQDIEEF-LTQSQ 516

  Fly   914 SEEEIITPFHRYELL-KGLSQEERALFR--EYEIYVDEIIAENLVD--SVITSSTYLRMEVDNRY 973
            :.|.:|....:|:.| :.:....|...|  .:|::.:|:| .:||.  .:|......:|..|:: 
  Rat   517 NYERLIEEIRKYQKLGEEIQYTSRKTVRLGMFEMHCEELI-RSLVKRADIICGKLIAKMFRDHQ- 579

  Fly   974 ENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNP 1038
            |.||.:.|.|.::.|      :.|.|...|.          ::..|.:.:::|            
  Rat   580 EVNTMLCEEFEKIAE------KALSTPPNTA----------ELMEMKAHIQKV------------ 616

  Fly  1039 YSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTY--LSEVKKFGRNL 1101
                 |..|..:|.::.|:..|.:...::.|..........:|::.|    |  :.|:....|.:
  Rat   617 -----ETTDMLDLGQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQW----YGRMGEIFDEHRKI 672

  Fly  1102 TLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETY----EDFFVFLRLNM 1162
            ..|:.:     :...|:||             :.::|:|      ..|:|    |:|:.|     
  Rat   673 IKDKTE-----QYQEGLKL-------------RCERFVE------ELESYAKQAEEFYTF----- 708

  Fly  1163 TGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQ 1227
                                       ..|:::|.::.:|.:                       
  Rat   709 ---------------------------GDLQDVQRYLKKAQV----------------------- 723

  Fly  1228 INEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQ 1292
            :|.|          |....|.:.|:|.|                                     
  Rat   724 LNSK----------LDAAADKIEQFNAE------------------------------------- 741

  Fly  1293 VDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFEL 1357
                                   .:.|.::|  |.|.               ||...:       
  Rat   742 -----------------------EEAFGWIP--SVYP---------------QRKKIQ------- 759

  Fly  1358 QGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKA 1422
            .|.:|.        |:|    ::.|:...:....|.:.|:.|::.:.::.:...:.|.|..|:||
  Rat   760 DGLNPY--------LRL----YETAVEFSTKHRAWTEGPYHKVNPDQVEADVGNYWRGLYKLEKA 812

  Fly  1423 MRTWEPFIFM----EASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLID 1483
            .......:.|    .|.:::....:..|..:.||.:|.|||..:...........|.:|:...||
  Rat   813 FHDSPNALAMTKKVRARVEDFKQYIPLVQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFID 877

  Fly  1484 LNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDH 1548
            :||..:.:..:.|.:.:.||.::||.:..:.|.|..|||....:..:...:|.|.:::...|:||
  Rat   878 MNLEPFLDRFEGISEAASKEYSLEKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDH 942

  Fly  1549 QGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDS 1613
            ..:.|.|..|.:|..:|.::|.|:.:|....:|:..|.:||..|.|||.|| .|.||.||:||:.
  Rat   943 IIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIF-SSPDIMSQMPEEG 1006

  Fly  1614 RRFDYIDKEFKALLAQMNADRNVV------RSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETK 1672
            |||..:||.::.::..:..:::|:      |...|. .|..|.||::|       |.||:|||.|
  Rat  1007 RRFTAVDKTWRDVMKMVVQNKHVLAVVTIERMLERM-KKSNELLELIL-------KGLNEYLEKK 1063

  Fly  1673 RLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL-----ISGSKNAAGMVAKELE 1732
            ||.:|||:|:|:.:||:|||...:|..|..||.|.::.:.::..     |:..|::.|    |:.
  Rat  1064 RLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSSEG----EVV 1124

  Fly  1733 EYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIM 1797
            |.|..:......|:||.||..:...|..::...:..::|.|....|..|:.:||.|..|..:|..
  Rat  1125 ELVDTISTTKARGQVEKWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTF 1189

  Fly  1798 WTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVG 1862
            ||.|...|.....:    ||:||..|...|:::::.|:.|.|:...|..:..:..:|||:|||:.
  Rat  1190 WTVEVQVAIPMGHK----ALEDYLGKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLA 1250

  Fly  1863 TIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLT------- 1920
            .::.|::...|.|:|.||||:.|..  ::....:.:|..||.||||||...::...||       
  Rat  1251 NLVKKRISDDTDFEWLSQLRYYWHE--NNLETKMINAGLRYGYEYLGNGEEIMKEELTVGIQFNL 1313

  Fly  1921 -DRCYI--------TLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSI 1976
             ..|.:        ||..:|||.:||||.||||||||||||||.:|:.....|||||:.:||.::
  Rat  1314 FPMCELYCSFLYSRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLAL 1378

  Fly  1977 GDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFI 2041
            |...|||...|||.||||||||.:|||||||.|:..||..|.|..:...|.|..:.|..|..|||
  Rat  1379 GKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFI 1443

  Fly  2042 TMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLS 2106
            |||||||||:|||:|||||:|..||:|||:|:|:||:|.:.||..||.|:.|.:..|.||.|.||
  Rat  1444 TMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLS 1508

  Fly  2107 KQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPA 2171
            .|.|||:|:||:||||..||.|:.......|:.:|:|::.|.|:||.::.|:|:|.|:..||||.
  Rat  1509 SQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPG 1573

  Fly  2172 LDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLN 2236
            :.:|:....:..|.|:.:...:.||..:.|..||:|:.|:..|||...|:|....||:..::.|.
  Rat  1574 VKLPKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLA 1638

  Fly  2237 KTYQN-------QKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKW 2294
            ....:       ::.|.....||||:||..:|:|..:..:.||.||:.::..|..|.......||
  Rat  1639 GALGDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKW 1703

  Fly  2295 IVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYIN 2359
            ::.||.:|.:|||::|||:||||.|.|.|.|.|.::.:|.|:||...|..|:||||||.|::|:.
  Rat  1704 LIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYME 1768

  Fly  2360 PQDLGWTPFIQSWLGTRTNSSEV---SMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCY 2421
            ||.|||.|.:.||:.|...|..:   ..:..|||:.||..::..|...:.::|.||...::....
  Rat  1769 PQMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMN 1833

  Fly  2422 LLDSML------TPQNVPNDCPK-DWYEIYFVFCIVWGFGSSLFQDQIIDWS--------NEFSK 2471
            |:|..:      ..|...||... ...|..|:|.::|..|:|...|..|.::        ...|.
  Rat  1834 LIDCFMDDFADENKQKERNDRENFSLLEGIFLFSLIWSVGASCTADDRIKYNKILRELMEGPISD 1898

  Fly  2472 WFLNEYK-------------AVKFPLSGTIFSFYIDHETKKFFP-----WTNLVPQF----ELDM 2514
            ...|::|             .|.||..|||:.:       :|.|     |...:.:.    .:..
  Rat  1899 LTRNKFKLLSGTEQTSSKALTVPFPEKGTIYDY-------QFIPEGLGRWDQWIKKLADTPPIPK 1956

  Fly  2515 DLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTI-LMNAKLSALPSDKYSVTNVPF 2578
            |:.....:|.|.:|.|....|..|.....|.:.:||:|:||:: ::|..|:.|..|.|....|.|
  Rat  1957 DVQFNEIIVPTLDTVRYSALMSLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNF 2021

  Fly  2579 NFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHH 2643
            :..||:...|.|:...|:|:....:||...||||.||||:|||..:.|....|..|:||::|:.:
  Rat  2022 SAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWN 2086

  Fly  2644 WYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMD 2707
            |||.:..::..:....|:..|.|..|... |.||..|||....:|..|..::|.|.:.||:.|: 
  Rat  2087 WYDLKDCSMIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIITINEFSDKSMFTIFSRILTWHL- 2150

  Fly  2708 NPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPN 2772
            ....||....:.|...:|...:||:...:.:.|||..|.||.|||||.:.:..||..|..||..|
  Rat  2151 RTCYKFPDDFLDLTTQIVNGTMTLYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAEN 2215

  Fly  2773 SNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVR-----------KGIEGVNDDVVY---A 2823
            ...:.|||:||..|||.|:|:|..|.:.....:.:|:|           |.::..||.:|.   .
  Rat  2216 KEAIKRLWVHEVLRVYYDRLLDNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDL 2280

  Fly  2824 QPLIYCHF-AKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYI-GAMNLVLFDDAMSHVCRISRIL 2886
            :.|::|.| .....|..|..|...|.|:.:::...|.||:.. ..||||||..|:.|:.||||||
  Rat  2281 RSLMFCDFHDPKREDFGYREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRIL 2345

  Fly  2887 ESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACC 2951
            :..|.:|||:||||||:||:||||:.::...:||::::|.|...:...::..:..|.........
  Rat  2346 KQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGV 2410

  Fly  2952 FLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNREN----CWKY 3012
            ||.||:::.||.||..||:||.:|::..||..||.:.|...:|...:|.......:.    .:..
  Rat  2411 FLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKTKQTDGSPIALFNM 2475

  Fly  3013 FIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPK 3077
            ||::.|:.|.|||..||:|...|:|.|||||||||.|||||..||:.|||:|:.|||.:|. :.:
  Rat  2476 FIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIE-MSE 2539

  Fly  3078 ELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLE 3142
            |:.....:.....|.:..::|..:....:||||.||.|:||||:.:..||.:|....:..:.|.|
  Rat  2540 EIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYE 2604

  Fly  3143 NGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQI 3207
            .||.||.|.:.:|..:|..|:....:||:.:::.|:::|::..|:.:|:|.......:|    .:
  Rat  2605 VGLDKLDSASSQVATMQGELEALHPQLKVASRQVDDMMIMIEKESIEVAKTEKIVKADE----TV 2665

  Fly  3208 EEDVTAKAKL----CEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLF 3268
            ..|....||.    |:.|..:|.|.|.:|..||:||...::|.:||..|||..|..|..|:.:|.
  Rat  2666 ANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILK 2730

  Fly  3269 SSKG-KIPK--------DRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKAL-QPYILDAEFS 3323
            ..|. |||.        :..|...:..:|:: :||.:|..|||.:|.|..:..: :.||.:.:|.
  Rat  2731 GIKADKIPDPTGSGKKIEDFWGPAKRLLGDI-RFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFV 2794

  Fly  3324 PEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQ 3388
            ||||...|:||.|||.|||.::.:..|..:|.||:..|..:|.|::.|.:.|......|.|::::
  Rat  2795 PEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELRIAMEGLRKKQAALREVQDK 2859

  Fly  3389 LNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDIL 3453
            |..||...:....||...:::....:..::.|.:|||||..||.||..|...|......|.||||
  Rat  2860 LAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYVNLTGDIL 2924

  Fly  3454 IISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSD 3518
            |.|..::|:|.||..|||. |.|.|..:.|  :..||.:|.......:.:...|..||..|||||
  Rat  2925 ISSGVVAYLGAFTSNYRQH-QTKEWSHSCK--ERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSD 2986

  Fly  3519 RMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGT-GLVVLRLSQRNYLDQVERAVSNGSVLLI 3582
            ..|.:|..|::.:.|:|||||||.|..||:|....| .|.:::||..:|:..:|..:..|:.:|:
  Rat  2987 LFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLL 3051

  Fly  3583 ENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLI 3645
            ||:||.:||:|.|||.:|..|:|  |.:::||..|::...||..:.|||.||||.||...:.||:
  Rat  3052 ENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLL 3116

  Fly  3646 NFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDV 3710
            ||.:|.:|::||||..||..||||||..:..|..|....|..||.:||.:|..|||:..|:|||.
  Rat  3117 NFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDE 3181

  Fly  3711 TLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSL 3775
            |.:..|..:|..|:||..|...|:.|..:||:.|..|||.|..:||::|.:.||..|.|:||:||
  Rat  3182 TAIKILSSSKALANEISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSL 3246

  Fly  3776 KAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGE 3840
            ..|..:|..::..:..::.|..|:..|.|..|:..:|...|.|||:||::|...|.:.:|::...
  Rat  3247 TWFINLFILSIENSEKSDILSQRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIHENA 3311

  Fly  3841 VEPTELDFLLR------FPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKF 3899
            :...|..|||.      .||    |:..|||....|..|..|:....||.:.::.....:.|||.
  Rat  3312 INKAEWRFLLTGGIGLDNPY----TNPCTWLPQKSWDEICRLDELHAFKTIRREFMRLKEGWKKV 3372

  Fly  3900 VDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFE 3963
            .||..|.:|.||.||:.| :..||:.|:||:|||::...::.||.:|||..:|:....:.::.|.
  Rat  3373 YDSMEPHHEIFPEEWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFG 3437

  Fly  3964 ESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWV 4028
            :|:....:.||||||.||:..:.|.....|:.  .....|:||||||..:|...:|.|.:.|.||
  Rat  3438 DSNCCAPLIFVLSPGADPMNALLKFADDQGYG--GSKLSSLSLGQGQGPIAMKMLEKAVKDGTWV 3500

  Fly  4029 ILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPT 4092
            :|||.||...|:|:|||..|. |..:.|..:|::|::.|:.:     .|..:|::.:|:|||.|.
  Rat  3501 VLQNCHLATSWMPTLEKVCEELSPESTHPDFRIWLTSYPSPN-----FPVSVLQNGVKMTNEAPK 3560

  Fly  4093 GMMANIHKA--LDNFSD-ETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGD 4154
            |:.|||.::  :|..|| |....|.|..|||.:|:.||:|||:|.|||||||.|||..|.||..|
  Rat  3561 GLRANIIRSYLMDPISDPEFFGSCRKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETD 3625

  Fly  4155 LTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYC 4219
            |.|||..|:.:|.....:|::.|||:.||..|||.:|||||||..|:.|.:|...||::.. :| 
  Rat  3626 LRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENP-QY- 3688

  Fly  4220 QGFPAPGI--LKYTGYH-NYID--DNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRM 4278
             .|.:.||  :..:|.| :||:  ..|| ...|.::|:::||:|....:.::.||..:...|.| 
  Rat  3689 -KFDSSGIYFVPPSGDHKSYIEYTKTLPLIPDPEIFGMNANADITKDQSETQLLFDNILLTQSR- 3751

  Fly  4279 TGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYI----IVAFQECERMNNLM 4339
               |||....|.::::..:..|||.|.|..|:|...|.|..  :.|.    .|..||..|.|.|:
  Rat  3752 ---SSGSGAKSSDEVVNEVAGDILGKLPNNFDIESAMRRYP--TTYTQSMNTVLVQEMGRFNKLL 3811

  Fly  4340 TELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLREL 4404
            ..::.|...:...:||.:.:|:.:|:::..:...::|..|...:|||:..|.|:.:|.:.||:.|
  Rat  3812 ITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMWMGKSYPSLKPLGSYVNDFLARLKFL 3876

  Fly  4405 EGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGA 4469
            :.|. :...|...||:|||..|:.||...|..|||...|:|.:..:.:|..  .:|...||.:|.
  Rat  3877 QQWY-EVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMD--DKEYKNAPEDGV 3938

  Fly  4470 YINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDI--KNVYECPVYKIRLRGPT 4532
            ||:|||::||.|:.|...:|::..|.|:..:||:::|..  .|.||  :..|..|:||...|..|
  Rat  3939 YIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPC--KKSDIPKRPSYVAPLYKTSERRGT 4001

  Fly  4533 ---------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
                     ||....|.|.:....|...||.||.|
  Rat  4002 LSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQ 4036

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 78/434 (18%)
DHC_N2 1368..1770 CDD:285579 115/417 (28%)
P-loop_NTPase 1903..2132 CDD:304359 129/245 (53%)
P-loop_NTPase 2217..2352 CDD:304359 51/142 (36%)
P-loop_NTPase 2510..2783 CDD:304359 92/279 (33%)
P-loop_NTPase 2860..3127 CDD:304359 108/272 (40%)
MT 3140..3480 CDD:289543 116/354 (33%)
AAA_9 3509..3722 CDD:289547 94/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 247/711 (35%)
Dnah7XP_008756271.1 DHC_N2 762..1162 CDD:285579 116/425 (27%)
P-loop_NTPase 1289..1535 CDD:304359 129/246 (52%)
P-loop_NTPase 1619..1762 CDD:304359 52/143 (36%)
P-loop_NTPase 1957..2226 CDD:304359 92/270 (34%)
P-loop_NTPase 2326..2589 CDD:304359 106/264 (40%)
MT 2602..2948 CDD:289543 115/352 (33%)
AAA_9 2978..3193 CDD:289547 94/215 (44%)
Dynein_heavy 3333..4027 CDD:281078 248/715 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.