DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah14

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017169555.1 Gene:Dnah14 MGIID:2444525 Length:4562 Species:Mus musculus

Alignment Length:4644 Identity:1187/4645 (26%)
Similarity:2029/4645 (44%) Gaps:892/4645 (19%)


  Fly   564 KEF----INFKNVFTALGLNE-----LPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELY---EY 616
            |||    .:|.:..|..|||.     :||.|                    .|::.|..|   ::
Mouse   159 KEFWMVTASFVSKITKTGLNMEDVELMPTMD--------------------WLYERHYFYLLQKF 203

  Fly   617 PLFDNER--GGYVSDIFNIMVQEIDDFTKML---------LDKWTVECWQGIQQDITLTLIEKDE 670
            .:|.|.|  ..:|:...|:..::.:.....|         |.:.::...:|:.:| .|||.:|::
Mouse   204 KIFYNFRLNKAFVTWKLNVKRRKTETSRSYLYNHLFCADELFQTSLLYVRGLCED-ALTLKKKNK 267

  Fly   671 ANELRVNFTERLIFALKDIKVVRLLGCDVS-VNLTKFFCREDELWQA------------------ 716
            .|.                ..:.|:..|.| .::.:.|| |::|.||                  
Mouse   268 DNS----------------STICLIKVDTSRTHVLEKFC-EEQLQQATQAVAQLEEIRSKAIVEI 315

  Fly   717 RVKLMRIAEWYN--DTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKY 779
            :...:::||..|  :.|| :.|:|......::    .|.:.||:      .:.||:    |::.|
Mouse   316 KKSALKVAEKKNVKEYFE-SKPSEINTTHFKL----PQYRNLLE------TNLRFL----KLIDY 365

  Fly   780 LHDRLVAAQEN--LEAIKESIRSWGKVPLFQRKDLNPALL-----------LHTDPREPIL-SIR 830
            |...|:....|  |..:.:......::| |.::..|.:|:           ..:|..|.:| |:.
Mouse   366 LFQELIRQLMNSALTQLLDLFTGSARMP-FSKEKKNESLMRTFRDRKIFSRKESDDDEFVLSSLT 429

  Fly   831 AANAADTQRLIDLLM---YVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFK 892
            |.:...:|..:|..:   :.:.::..|:.:.|:                  ||..:|:...:.  
Mouse   430 APSFQSSQPKLDTDVKETFNSHRVAMDLKKTYA------------------PIFEISLCLRLP-- 474

  Fly   893 KKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDS 957
               .:.|..:|||...::....||.::......|..|..|.|  |:..:|    ::......:..
Mouse   475 ---TMNDSPEDLEGNNQKSENCEESLVCDEEELENRKRTSSE--AMLSQY----NQPSKFGTLLK 530

  Fly   958 VITSSTYLRMEVD-NRYENNTPIFE----IFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMN 1017
            .|.|.:.|::|.| .|:.|.  .||    :||   |||     .||.|  |.|...|.||...:.
Mouse   531 RILSDSGLQLESDQERFYNK--FFEFPTNLFM---EPN-----RLDFS--TQFQNMIATIEKYVT 583

  Fly  1018 NMMSLLKRVAQDP-----------------TEVTNMNPY-------SFYDELQDKSELDKQRVEI 1058
            .::.|    .|||                 |:..::..|       .||......::...:.|.:
Mouse   584 TIIPL----HQDPRLSILVDLVSVPDLSNETKTKSVVKYKKQTRWPDFYILFDTDTDYQNKIVTL 644

  Fly  1059 MNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGL 1123
            :..|..::..|..:...|:::  .:|.:|:..::....|..|||..|                  
Mouse   645 LTIIGNSVGLVSDYSCRFLKY--CYIVEKAKVMTTKLPFMTNLTSIE------------------ 689

  Fly  1124 EYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWIS---------- 1178
                   :|..:.||.....||.|. |.|.......:|...:::|.|..|...|.          
Mouse   690 -------FKRIIHKFRSYLKQIVTM-TIEIRIGIFYVNSLDYQLACLPYVDGIIQMSYNLLQCTI 746

  Fly  1179 -------LFKLD-LINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIY 1235
                   |..|| |::::.....||::||:..|.:       ||      |.|.|.:|.:..|  
Mouse   747 EEKSANLLETLDSLLHQLDTEPVELEEFVEHLNFL-------DD------IFSSLTEIEKDFC-- 796

  Fly  1236 DSMFDPLKEIIDLLRQYNYEFKDTELA-------QINELPDA--WMKVKRLAATTK---QLIAPI 1288
                 .:.|:..::|.|.....:.::|       :.|.|..:  ::.:.|..:.||   .|.|.|
Mouse   797 -----TISELYSIVRHYQINVSEEQIAIYKIIFMKFNHLKTSMKFVAMNRETSLTKFKNGLEAYI 856

  Fly  1289 QSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELID--ESDLELVALEERQRSLAES 1351
            .|.:||:        .|:.:..|...|......:|  ...|::.  |::.|.:.|:.:..|..::
Mouse   857 VSLRVDV--------SNLKDKIRTPLLLAASTPIP--KAKEIVQSLEAEAESLTLKVKTYSNYQN 911

  Fly  1352 -------------------AVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPW 1397
                               .||.|:.     :|| |  ||.|.|::|:..........:|:....
Mouse   912 YYDQAYFRMNAINTNEMSHIVLSEIS-----EIE-C--DLMLRKLLWEAQEEWGKYFWEWRNCTL 968

  Fly  1398 KKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIEL 1462
            :.|||:.:.....|:...:..|:|.:...:....::.|:.:....|..:|.|.|..::.|||..|
Mouse   969 QSIDIDLVKNNVSKWLHIIIVLEKGLPKNDMVPLLKQSVLDFRQELPIITALGNACLKARHWETL 1033

  Fly  1463 MQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIH 1527
            ...|....|::.:.:::.|:.|.|..||.::..|...:..|.|:||.|..|...|.|    |.:|
Mouse  1034 QGITGRSTSLNKNLSIEKLLALKLFPYERKINEISISATNEAALEKMLFKIIDLWNT----TPLH 1094

  Fly  1528 ------DRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWF 1586
                  :..||.::.::::||..|||.|..|.::..|.|:...:..|..|...|:...|.|..|.
Mouse  1095 LVPHLTEGRSILIISSTDDLITQLEDSQAILASIKGSSYLRPIKQLVIKWNQNLTLFSQTIDEWV 1159

  Fly  1587 EVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG-----SK 1646
            ..||.|..||.|| .|.:|:.||..:::.|..:...:|.:::::....|.:..|..:|     ..
Mouse  1160 TCQRTWLSLEPIF-QSLEIQKQLAAEAKLFSQVLVMWKEIMSRVLNKLNALHITISTGILGVLKS 1223

  Fly  1647 LYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSM 1711
            ...|||.:       :|:|.:|||.||:|:|||:|:|:.:|||||:|..||..|..||.|.::::
Mouse  1224 CNSHLESI-------KKSLEEYLELKRMSFPRFFFLSNDELLDILANSKNPESVQPHLVKCFENI 1281

  Fly  1712 GKLNLIS---GSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFY 1773
            .::.|..   |..:...:::.|.|..| ..:.......||.|:..:...|.|.|:..:.:.:..:
Mouse  1282 RRILLWKQDVGPPSVKMLISAEGEGLV-MPKKIRVRASVEQWMVNVEKSMFDVLKKFIIQGIEDW 1345

  Fly  1774 DHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALK---DYNKKQITQ------LN 1829
            .:.....|:...|.|..:...|||:              |.:.||   .||.::|.:      |.
Mouse  1346 KYHTFSDWVMSHPGQVVITVIQIMF--------------YNDCLKGFMSYNPREILEAVQARLLR 1396

  Fly  1830 NL--IILLLGDLTAAERQKIMTICT--IDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKID 1890
            :|  |.:|:...|:.:|.|.|...|  |.||.||::..::.||:.....|:|...||::|:.|..
Mouse  1397 HLEDIAVLVTLNTSNQRTKTMLAATLIICVHCRDIMSDVLVKKIFSIQDFEWTRHLRYKWNGKQK 1461

  Fly  1891 DCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLG 1955
            .|:....:..|.|.|||||..|||||||||:||:::|:::|:..:||..|||||||||||.|||.
Mouse  1462 LCYVLQANTSFVYGYEYLGCAPRLVITPLTERCWLSLSEALYFNLGGCTAGPAGTGKTETVKDLA 1526

  Fly  1956 RALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSK 2020
            ::.|....||||.|.:|||.||.:..||.|:|||.|||||||||:|||||:|.|:..|:.|..|.
Mouse  1527 KSFGKHCVVFNCFEDLDYKIIGKLFFGLVQSGAWCCFDEFNRISIEVLSVIASQILAIKIAKSSY 1591

  Fly  2021 KQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQ 2085
            ...|...|..|.:..:..|.||:|||..||.|:|:|||.|:|..:::||.:.:|:|::|.:.||:
Mouse  1592 SVRFVLDGREIRINMSCAVLITINPGTTGRVEIPDNLKYLFRLVSIMVPHYKMITEVILFSYGFK 1656

  Fly  2086 EARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDR--------QRPEDQVLM 2142
            .:|.|:.|.:.||.|..:.||||:|||:|||.:|:||::......:.:        :..|..:|:
Mouse  1657 SSRSLSGKIVHLYDLADKQLSKQEHYDFGLRTLKTVLIMTEKKILEHKCGRGEHLSELDESLILI 1721

  Fly  2143 RALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQ 2207
            .|:|:.::.|::.:||..|..:|.|:||.:.|.:..:...|..|..:...|..|.......||:|
Mouse  1722 EAIREASLSKLLPEDVLPFEKIIEDVFPRITVSKINHLTLEKAISTATEQLGFQHWPSQKEKIIQ 1786

  Fly  2208 LEELFAVRHSVFIIGFAGTGKSEVWKTLNKTY--------------------QNQKRKPHYNDLN 2252
            ..:...|...|.::|..|.||:.|.|.|.|..                    ..:|.|.....||
Mouse  1787 FYQQLQVCVGVILVGPTGGGKTTVRKILEKALVTLPVTSAMLMKERQSDSKSTGKKGKVDVCVLN 1851

  Fly  2253 PKAVTNDELFGIVNPSTREWKDGLFSILMR-----------------------DQANLGGTG--- 2291
            ||.:|..||:|.:|.:|.||.|||.|..:|                       |.:|:...|   
Mouse  1852 PKCITLSELYGQLNINTMEWNDGLLSAAIRNYVHMNTADYSKIDNDFEMSGITDLSNIFQVGFST 1916

  Fly  2292 -------------------P-------KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALT 2330
                               |       :||||||.||.:|||:||||:|:.:.|.||::|||:||
Mouse  1917 IADMDNNIFMGELEKSFKTPEIHDFDWQWIVLDGPIDSLWIENLNTVLDETRTLCLANSERISLT 1981

  Fly  2331 KEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWL--GTRTNSSE-VSMLNVLFDKY 2392
            .::|::||..||..|||:.::|..::|::|.||||.|:::|||  .:::.|.: :..|.::.::.
Mouse  1982 NKIRIVFEADSLFDATPSVITRCAMVYMDPVDLGWEPYMKSWLLKSSKSISQQGIQCLEMMINRS 2046

  Fly  2393 VPPLLDIFRTRLRSIT-PISDIARLQMTCYLLDSMLTPQNVPNDCPK------------------ 2438
            |...:...:...:.:. ||.|:..:...|.:||:.....::....||                  
Mouse  2047 VTKGMKFLKKHRKFLPYPIQDVTVVITLCRILDAFFEFMHIKQGTPKSHEAMDSESPTETKVKVK 2111

  Fly  2439 ------------DWY------------EIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKA 2479
                        .|:            :..|||...|.||..|.::...:....|.|.|.::..|
Mouse  2112 FKEETSHHKDEGSWFLERNPEKLPMMIQKIFVFAFTWAFGGILKREDQHEEDILFRKSFEHDSLA 2176

  Fly  2480 -----------------------VKFPLS-GTIFSFYIDHETKKFFPWTNLVP------QFELDM 2514
                                   :..|.| .::|.:::|.:..:|.||::|||      |.|..:
Mouse  2177 EVNYNFDIFVREVFEDDSERDTGISLPGSERSVFGYFVDVQQCEFMPWSDLVPTAHTLIQKETSL 2241

  Fly  2515 DLPLQS---------------NLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLS 2564
            ....|.               |.:.|.:|..|.|.|...:...:|::|.|..|.||::.:|..|.
Mouse  2242 LTDFQGSSENVLRMNEYGECVNYMATRDTICLSFLMSLFLRNSYPVLLTGDCGVGKSVAINKMLE 2306

  Fly  2565 ALP-----SDKYS---------------------------------------------------- 2572
            .|.     :.||.                                                    
Mouse  2307 KLEGRGTLNIKYGSILGKVLLHNDIKRSSLRQNINILIGDPTKIIGAGLEQSAKKEEAKANDSTV 2371

  Fly  2573 -------VTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQ 2630
                   |:.:.|....|:...:.:|.:.|.::.....|...|.|::.|:||:|||.||...|..
Mouse  2372 INDKGIIVSTINFTSTMTAAKTKELLLRKLVRRTKDILGAPKNNRIVVFIDDLNMPIVDACGTQP 2436

  Fly  2631 PHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALF 2695
            |..||||.:|....||.::...:.|...:::|....|.....|.|||.:||.:..:..|.|.||.
Mouse  2437 PLELIRQLLDMGGVYDTERNMWKSIQDLSLIAAYTSSVSGKEISPRLLKHFSTLVLPHPPQSALC 2501

  Fly  2696 HILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFT 2760
            .:..:.|..:..  |..|...|.|..:.:|..::.::.:|....|||..|.||.||.|||..:..
Mouse  2502 TVFQAHLGMYFS--INNFVNEVQKCRDEIVHCSLAIYYEVCKKLLPTPTKCHYIFNPRDIFKLLL 2564

  Fly  2761 GVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVY--- 2822
            |::.::.....:......|.:||..||:.|:|.|.::.:.|.:|:|..::..::      :|   
Mouse  2565 GLMQADKNIINSKEMAALLLVHEASRVFHDRLTDQSEKSLFYQILSTELQNHLQ------IYWSH 2623

  Fly  2823 ----AQPLIYCHFAKGLTDIK-------YMPISGWDRLKSLLDEAQDRYNDYIGAM--NLVLFDD 2874
                .:|:::..|    .||.       |.....::.|.|:|.:.|.:.:.....|  ::|.|.:
Mouse  2624 ERLMNKPVLFVDF----MDINKPHRKRVYQNTDNYNELLSILTKFQQKLSSSSLEMSHSVVFFKE 2684

  Fly  2875 AMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATL 2939
            |:.|:.|.:|.|..|..:.||:|:.|.||::...:|.:::...|.::.::.:|::|:.|.....:
Mouse  2685 AIDHITRTTRALRQSGSHMLLLGIDGCGKETYATIACYLAEYKVCKVPISHNYAISEFKEMFKKV 2749

  Fly  2940 YMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVD 3004
            :::.|::.:....::|:.:.....||..:|.::.:|.|..:|.::|:::||..|....:||..::
Mouse  2750 FIQTGLEETPTVVMVTNLQEEHVSFLEDLNYIINAGKISNMFENEELDSIVMRVGTFAEQLTCIE 2814

  Fly  3005 NRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFL 3069
            :|:.....|..:|...|.:.: .|..|...|...|.:|::::..|||||..||.:||..|:..:|
Mouse  2815 DRKYLLSLFQRRVSKNLHICM-ISATGPNFRHNCRVYPSMISSCTIDWFQRWPDEALLVVASSYL 2878

  Fly  3070 SE-ITVLPKELALPVSNFMAF------VHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLL 3127
            .| :.|..||     .....|      :||::.|:|..|.....::.|.||..:.:.:..::..|
Mouse  2879 KEKLKVEDKE-----DKIREFAPTCVEIHKSMKDLSAKYFEETGKHYYITPSCYFKFLETFTHSL 2938

  Fly  3128 HEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKV--QEVELKIKNQEADNLIIVVGTENEKV 3190
            ..:.:....:|.|...||.|:...|..|..:|:.|.|  .::|.|.|.:|    |::     ||:
Mouse  2939 RIRQEEMQTKRNRFYMGLSKILEATVLVTDMQEELLVIGPQIEQKAKEKE----ILM-----EKL 2994

  Fly  3191 SKERAFASKEEKNVRQIEEDVTAKAKLCEE-------DFLKAQPALIAAQEALNTLNKNNLTELK 3248
            .|:.....|.:..|:|.||.|..:.|:.||       :.....|:|..|..|||.|:|::::||:
Mouse  2995 RKDSQIVEKVQMLVKQDEEIVAEQVKIVEEYAQKTSNELKNVLPSLDKAIVALNALDKSDISELR 3059

  Fly  3249 SFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKAL 3313
            .:..||..|::|..||.:|      :.|..:|...:..:.:. .||..|||.||..|...|...|
Mouse  3060 VYTRPPYLVLTVMNAVCIL------LEKKPNWATAKLLLSDT-SFLKRLINIDKDSIPDKVFLRL 3117

  Fly  3314 QPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTAL 3378
            :..:...:|:|.||...|.|...:|.|||.:|.:::|..||.||:..:.|::..::.|:.:|...
Mouse  3118 KKILNLPDFNPNKIAMVSVACCSMCQWVIALNNYHEVQKVVRPKQAQVAEAQNVLQIAKQRLLEK 3182

  Fly  3379 NLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTF 3443
            ...|..:|:.|..|...|.:.:.:|.:...........:..|:.|:..|..|||||.|::..:..
Mouse  3183 QRGLQLIEDHLQFLHTSYRDIVTEKHQLASRKKLATKRLQCASVLLTVLEDEKIRWQETINEIDC 3247

  Fly  3444 GIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIA 3508
            .::.:.||..:.|..::|:|..|..:|:.:.:| |......::  |..:......:::.:..:|.
Mouse  3248 KLKGVCGDTFLSSACLAYIGVLTPEFRELVIQK-WKDFCTRAE--IILSPNFSLIDVMAEKNEIR 3309

  Fly  3509 EWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERA 3573
            .|:|||||..:..||||.::.:::::||:|||..|.:.|::...|..|..:.....||..::..|
Mouse  3310 RWHNQGLPLGQHLAENAILMKRTKQWPLVIDPHKQALHWIRQMEGPRLQEISAQDSNYTKKLVIA 3374

  Fly  3574 VSNGSVLLIENIGENIDPVLNPLLGRQLI-KKGT-VLKIGDREIDFNSRFRLILHTKLANPHYKP 3636
            :..|..:|::|:.|...|.|..:|.:.:. |:|. .:||.|.||:||..|||.|.|:|.||::.|
Mouse  3375 MQAGDPVLLQNVPETFPPNLRAMLKKDVCQKRGQYYIKIDDTEIEFNKNFRLYLSTELENPNFFP 3439

  Fly  3637 EMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSS 3701
            .:....|:||||||..||:|:||:.||..|.|.||..|.:|.:..:...|||:.|||..|..|..
Mouse  3440 SVYNFVTIINFTVTFQGLQDELLSTVVSHEVPHLENQRAQLLESISLDAITLEELEDKTLTLLQK 3504

  Fly  3702 AGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFK 3766
            |..:||:|..:|..|.|.|.|::||..::.|.:....:|.:.|:.|.|.|.|.:::||::..|..
Mouse  3505 AEGSVLDDEEIVETLRKCKMTSNEISKRIKETEKAESKIQATRKNYLPIATRGALLYFVVAGLSH 3569

  Fly  3767 INPIYQFSLKAFTVVFNNAMLKAMAAEK--------------------------------LKDRV 3799
            :..:|||||:....||.:..:.....||                                |.:.:
Mouse  3570 VEKMYQFSLEWLRGVFVSFTVSKTKEEKHDWKTDETSQEKADEVSLSSSEQENLESERIPLAENI 3634

  Fly  3800 ENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQIL----------VNLGEVEPTELDFLLRFPY 3854
            :|.|:::|...|...|..||.:.||.|...||..|:          .::|.:...|.:..|....
Mouse  3635 KNAIETLTRNVFKVVSSALFNEHKLCFSFALCTTIMRGNSSDTLMADDIGFLPEEEWNIFLYTSI 3699

  Fly  3855 MPN-----------------QTSNFTWLTHVGWGGIRALNNQ-AVFKGLEKDIEGSHKRWKKFVD 3901
            :.|                 :..:..|:..:.|...:.::|| ..|..|...:..:.::|..|.|
Mouse  3700 LINIKNILSKPRLNSIFEIRRNGHLQWVPDLRWRQCQYISNQMEPFSLLCTSLLSNEQQWNAFKD 3764

  Fly  3902 -------------SESPENEKFPGE--------------------WKGKSAIQRLCIMRCIRPDR 3933
                         |::|..:|.|..                    |:..:..|||.:::.:||||
Mouse  3765 AMAVYSLMSRPFFSDAPLPQKKPRSAKEAELLDESDEMLDPVTFPWEKLTQFQRLILIKILRPDR 3829

  Fly  3934 MSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVD----PLKDVEKLGKSLGF 3994
            :..:::.||.||:|.:||...::....:|.||:.:|.:....|.|:|    .|:..|:      |
Mouse  3830 LENSIKKFITEKMGGEYIPDTTVNLKESFSESTAQTPLILTHSYGIDLNNLLLRFAEE------F 3888

  Fly  3995 SFDHENFHSVSLGQGQEIVAENAIEIASQYGH-WVILQNIHLVARWLPSLEKKMESSLSN---VH 4055
            .........:|||..||..||..|..|.:..| ||.|||.||...::|.|...::|..|.   :.
Mouse  3889 KGTTPKVTMISLGPDQENKAEEIIFKAVRKAHQWVFLQNCHLAESFMPRLTAIIDSFSSPDMVLD 3953

  Fly  4056 TSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNF-----SDETLEMCSK 4115
            ..:||:||::.:|     ..|..||:.::||..|||.|:.:|:   |..|     .:.|.||..|
Mouse  3954 PDFRLWLSSKASG-----FFPITILQKSVKIAVEPPQGLKSNL---LQMFGYGGSGEVTEEMFEK 4010

  Fly  4116 E---TEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDL 4177
            .   ..:|.||||:|.|.||:.||:.:|..|||..|.|:..||.:|:.||.|.|...:.|||:::
Mouse  4011 PDCGPWWKKILFSICLFSAVLIERKAYGTLGWNIPYRFSSSDLEVSLKVLGNVLSGRSEVPWKEV 4075

  Fly  4178 RYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG---FPAPGILKYTGYHNYIDD 4239
            .||..|:.:||.:.|:||.|..:|..::|..||::..:..:...   .|.|.........|.|..
Mouse  4076 NYLISEVTFGGRVVDEWDMRCLKTLFDKFCNPEMLKDDYSFSSNEMYQPVPSSASLKDCINIIQS 4140

  Fly  4240 NLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETV-SQEDIIKNIIEDILD 4303
            ....:||.:.|:|..|........:::....:..:||:...|....:.: |.:.::..::.||:.
Mouse  4141 FPDDDSPEILGIHPEATHTGSEIKAQKYIENLIYMQPKDAPGYLMIKPMQSNDSVVMEVLSDIMS 4205

  Fly  4304 KTP--------------TPFNIL-------ELMGRVEDRSPYI---IVAF--QECERMNNLMTEL 4342
            :.|              :.|:.:       .|...::...|.|   ::.|  :|.||.|.|::.:
Mouse  4206 QLPLTVESEDVSEPGLQSTFSFIVSSPIWERLHENIQGYDPLIHSVLIPFLKKEIERFNKLLSVI 4270

  Fly  4343 KRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGW 4407
            .:||..|.|.:|||..::..:|:........:||..|.|.||.|...|..|.|:|:.|:.....|
Mouse  4271 HKSLKSLQLAIKGESILTPDLEETYDSFLRARVPMLWQKNAYKSCKPLSIWVSNLIQRVNFFNTW 4335

  Fly  4408 V----------------------------ADFR------MPSSIWLAGFFNPQSLLTAIMQQTAR 4438
            .                            .||:      .|:..||:.||:||:.|||::|...|
Mouse  4336 AKVAYTAIHHRYMLFITTWRQLGQKSRHPTDFKTEITDGFPARYWLSAFFSPQAFLTAMLQDYGR 4400

  Fly  4439 KNEWPLDRMCL------------NCDVTKKWKEELTTAPR----------EGAYINGLFMEGARW 4481
            .....:|.:..            ..|::|..::.|....|          :|.||.|||||||||
Mouse  4401 AQGISMDTLTFTHKVIYNISVTQEDDISKLLQKRLNIVRRAFQQHQDHSPKGVYIFGLFMEGARW 4465

  Fly  4482 DMKMGTIADAFLKEL---FPAMPVLYIK----AVTQDKQDIKN---VYECPVYKIRLRG------ 4530
            |.:...:.|:...:|   ||.:..|..|    :.:||.....:   .:|||||....|.      
Mouse  4466 DPEQEVLEDSLPSQLCCEFPDILFLPTKITEPSASQDSDQTASDLQTFECPVYYTPERSRNMIGL 4530

  Fly  4531 PTFVWT-FNLKSRERASKWTLAGVCLLLQ 4558
            ||.|.| .:|.:::..|.|....|.||.:
Mouse  4531 PTTVLTSVHLPTKKPPSHWITMQVALLCE 4559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 47/243 (19%)
DHC_N2 1368..1770 CDD:285579 112/416 (27%)
P-loop_NTPase 1903..2132 CDD:304359 115/229 (50%)
P-loop_NTPase 2217..2352 CDD:304359 64/207 (31%)
P-loop_NTPase 2510..2783 CDD:304359 78/352 (22%)
P-loop_NTPase 2860..3127 CDD:304359 67/276 (24%)
MT 3140..3480 CDD:289543 98/349 (28%)
AAA_9 3509..3722 CDD:289547 83/215 (39%)
Dynein_heavy 3864..4549 CDD:281078 220/838 (26%)
Dnah14XP_017169555.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.