DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah7b

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001355646.1 Gene:Dnah7b MGIID:2684953 Length:4024 Species:Mus musculus

Alignment Length:4295 Identity:1307/4296 (30%)
Similarity:2064/4296 (48%) Gaps:633/4296 (15%)


  Fly   488 DPDAENSLFQRDRLSFKAKTDVMERMVS---FQFEKGLEDTHDLLLAGSLL--LRPIIKKHVEPL 547
            |.|.|:.:.....:. ||.|...|:.:|   :....||:..|...:..|.|  :..::.:|::.|
Mouse   136 DGDLESDVIDESGIP-KATTTAREKDISRYYYYIRHGLDTDHVAPMEDSWLEHVLQLVPQHLKIL 199

  Fly   548 ---MHVIVDDFEEE-IMCVKKEFINF------------KNVFTALGLNELPTD----DCFPK--- 589
               :.|:.|:..|: ::.|||..::|            |       :.|||..    :..||   
Mouse   200 NNSIMVLSDEIREDYLLSVKKSIVDFVLKDPRKKDDDGK-------ITELPPHRAEMEVLPKPWR 257

  Fly   590 ---------VSGAISFLKKLRHRIIGL----HKEHELYEYPLFDNERGGY-VSDIFNIMVQEIDD 640
                     :...::.:..:...::.|    .|:..|.:...|.|.:... :|:..||:::.::.
Mouse   258 RSFLSACSYIRDHLNAMNPMMLAVLDLWHSTFKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMES 322

  Fly   641 FTKMLLDKWTVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTK 705
            ..:|||..|                            |.|......|..|..:|.....|..|..
Mouse   323 AKEMLLKTW----------------------------FPEVQNIYYKGNKKKQLPTGKSSAKLDS 359

  Fly   706 FFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRL------IAAEMILIEEQMKPLLDF----- 759
            ||.....|...:::.:.:....:.|...|.|.|...      ....:||.::.:|...||     
Mouse   360 FFNCAATLMTLQLQDLILVSMQDFTDLIAQPPESTRAFEHPGFIMRLILDKKTIKFAPDFNDYID 424

  Fly   760 IKWNAFSQRFIVMIFKMVKY---LHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTD 821
            |..|.:.    :|| |||.:   :..:|.:..|          |..|....:...||..:..|.:
Mouse   425 ILINVYE----IMI-KMVSFVPRVETKLYSQWE----------SKSKPTTLKPIILNEIIDTHKE 474

  Fly   822 P-REPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSV 885
            . ||.:|                              |.|:.|.||                   
Mouse   475 KIREVVL------------------------------RESVAPTEH------------------- 490

  Fly   886 MTSVKFKKKREVI---DEEDDLEEFEEEQSESEEEIITPFHRYELL-KGLSQEERALFR--EYEI 944
               :|...|.:.:   ..|.|::|| ..||::.|.:|....:|:.| :.:....|...|  .:|:
Mouse   491 ---LKMYDKYQFLITGKAERDIDEF-LFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEM 551

  Fly   945 YVDEIIAENLVD--SVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNV-------------VYF 994
            :.:|:| ::||.  .||......:|..|:: |.||.:.:.|.::.|..:             .:.
Mouse   552 HCEELI-KSLVKRADVICGKLIAKMFRDHQ-EVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHV 614

  Fly   995 RNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEV-TNMNPYSFYDELQDKSELDKQRVEI 1058
            :.|:|   |......:.::|..|.:..|::.|...|.:: .|.:.:.:|..:             
Mouse   615 QKLET---TDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRM------------- 663

  Fly  1059 MNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGL 1123
                          |:.|.|...: |.||:....|..||.....::|                  
Mouse   664 --------------GEIFDEHRKI-IKDKTEQYQEALKFRCERFVEE------------------ 695

  Fly  1124 EYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRV 1188
                |..|.:|:::|          .|:.|                                   
Mouse   696 ----LESYAKQVEEF----------HTFGD----------------------------------- 711

  Fly  1189 KNSLKELQDFVDEANIVL-KIELQKDDFEGLVKILSVLNQINEKQCIY---DSMFDPLKEIIDLL 1249
               |.::|.::.:|.::. |::...|..|          |.|.::..|   .|::...|:|.|.|
Mouse   712 ---LLDVQRYLKKAQVLNGKLDAAADKIE----------QFNAEEEAYGWVPSVYPQRKKIQDGL 763

  Fly  1250 RQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKF 1314
            ..|                                                              
Mouse   764 NPY-------------------------------------------------------------- 766

  Fly  1315 LSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMW 1379
                      |..||.                                                 
Mouse   767 ----------LRLYET------------------------------------------------- 772

  Fly  1380 DFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLR 1444
              |:...:....|.:.|:.|::.:.::.:...:.|.|..|:|........:.|...:::::...:
Mouse   773 --AVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFK 835

  Fly  1445 ----AVTELQNPAIRDRHWIELMQTTKVKFSM---DDSTTLKDLIDLNLHEYEEEVKNIVDKSVK 1502
                .:..:.||.:|.||| |.|.|. |.|.:   ||||.. ..||:||..:.:..:.|.:.:.|
Mouse   836 QYIPLIQVICNPGLRPRHW-EAMSTI-VGFPLLPSDDSTVF-SFIDMNLEPFLDRFEGISEAASK 897

  Fly  1503 EMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHE 1567
            |.::||.:..:.|.|.:|||....:..:...:|.:.:::...|:||..:.|.|..|.:|..:|.:
Mouse   898 EYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQ 962

  Fly  1568 VRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNA 1632
            :|.|:.:|....:|:..|.:||..|.|||.|| .|.||.||:||:.|||..:||.::.::..:..
Mouse   963 MREWEGKLLLLQEILDEWLKVQATWLYLEPIF-SSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQ 1026

  Fly  1633 DRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNP 1697
            |:.|:...  :..::.|.|:...::|.|..|.||:|||.|||.:|||:|:|:.:||:|||...:|
Mouse  1027 DKRVLAVV--TIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDP 1089

  Fly  1698 ALVARHLTKLYDSMGKLNL-----ISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDK 1757
            ..|..||.|.::.:.|:..     |:..|::.|    |:.|.|..:......|:||.||..:...
Mouse  1090 TRVQPHLKKCFEGIAKVEFTETLDITHMKSSEG----EVVELVDTISTAKARGQVEKWLVELERT 1150

  Fly  1758 MRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNK 1822
            |..::...:..::..|....|..|:.:||.|..|..:|..||.|...|..|..:    ||:.|..
Mouse  1151 MIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAIPKGHR----ALEGYLA 1211

  Fly  1823 KQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDP 1887
            |...|:::::.|:.|.|:...|..:..:..:|||:|||:.:::.||:...:.|||.||||:.|..
Mouse  1212 KCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQE 1276

  Fly  1888 KIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTK 1952
              ::....:.:|..||.||||||:|||||||||||||.||..:|||.:||||.||||||||||||
Mouse  1277 --NNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTK 1339

  Fly  1953 DLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAI 2017
            ||.:|:.....|||||:.:||.::|...|||...|||.||||||||.:|||||||.|:..||..|
Mouse  1340 DLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGI 1404

  Fly  2018 KSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAE 2082
            .:..:...|.|..:.|..|..||||||||||||:|||:|||||:|..||:|||:|:|:||:|.:.
Mouse  1405 NAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSC 1469

  Fly  2083 GFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRD 2147
            ||..||.|:.|.:..|.||.|.||.|.||::|:||:||||..||.|:.......|:.:|:|::.|
Mouse  1470 GFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIID 1534

  Fly  2148 FNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELF 2212
            .|:||.::.|:|:|.|:..||||.:.:|:....|..|.|:.:...:.||..|.|..||:|:.|:.
Mouse  1535 VNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMM 1599

  Fly  2213 AVRHSVFIIGFAGTGKSEVWKTLNKTYQN-------QKRKPHYNDLNPKAVTNDELFGIVNPSTR 2270
            .|||...|:|....||:..::.|.....:       ::.|.....||||:||..:|:|..:..:.
Mouse  1600 IVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSH 1664

  Fly  2271 EWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRL 2335
            ||.||:.::..|..|.......||::.||.:|.:|||::|||:||||.|.|.|.|.|.::.:|.|
Mouse  1665 EWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNL 1729

  Fly  2336 LFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEV---SMLNVLFDKYVPPLL 2397
            :||...|..|:||||||.|::|:.|..|||.|.:.||:.|...|..:   ..:..|||:.||..:
Mouse  1730 IFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSV 1794

  Fly  2398 DIFRTRLRSITPISDIARLQMTCYLLDSML------TPQNVPNDCPKDWYEI---YFVFCIVWGF 2453
            :..|...:.::|.||...:|....|:|..:      ..|...||  ::.:.:   .|:|.:.|..
Mouse  1795 EFIRRHTKELSPTSDTNLVQSLMNLIDCFMDDFADENKQKERND--RESFSLLEGIFMFSLAWSV 1857

  Fly  2454 GSSLFQDQIIDWS----------------NEF----------SKWFLNEYKAVKFPLSGTIFSFY 2492
            |::...|..:.:.                |:|          ||.|:     |.||..|||:.: 
Mouse  1858 GATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFI-----VPFPEKGTIYEY- 1916

  Fly  2493 IDHETKKFFP-----WTNLVPQF----ELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLI 2548
                  :|.|     |...:.:.    .:..|:.....:|.|.:|.|....|..|.....|.:.:
Mouse  1917 ------QFIPEGLGRWDKWIKKLADTPPIPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFV 1975

  Fly  2549 GPSGSGKTI-LMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMI 2612
            ||:|:||:: ::|..|:.|..|.|....|.|:..||:...|.|:...|:|:....:||...||||
Mouse  1976 GPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMI 2040

  Fly  2613 YFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPR 2676
            .||||:|||..:.|....|..|:||::|:.:|||.:..::..:....|:..|.|..|... |.||
Mouse  2041 VFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPR 2105

  Fly  2677 LQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLP 2741
            ..|||....:|..|..::|.|.:.||:.|: ....||....:.|...:|...:.|:...:.:.||
Mouse  2106 YMRHFNIVTINEFSDKSMFTIFSRILAWHL-RTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLP 2169

  Fly  2742 TAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTD----INSFK 2802
            |..|.||.|||||.:.:..||..|..||..|...:.|||:||..|||.|:|||..|    |:..:
Mouse  2170 TPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQ 2234

  Fly  2803 KIVSDIVRKGIEGV-------------NDDVVYAQPLIYCHF-AKGLTDIKYMPISGWDRLKSLL 2853
            :|:.:.:::....:             .||:   :.|::|.| .....|..|..|:..|.|:.::
Mouse  2235 EILKNYMQEDFHDLFKNLDFNQDGTVEEDDL---RSLMFCDFHDPKREDFGYREIANVDALRMIV 2296

  Fly  2854 DEAQDRYNDYI-GAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLD 2917
            :...|.||:.. ..||||||..|:.|:.||||||:..|.:|||:||||||:||:||||:.::...
Mouse  2297 EGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYS 2361

  Fly  2918 VFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFP 2982
            :||::::|.|...:...::..:..|.........||.||:::.||.||..||:||.:|::..||.
Mouse  2362 LFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFA 2426

  Fly  2983 DDEVENIVNAVRNEVKQLGIVDNREN----CWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPA 3043
            .||.:.|...:|...:|.......:.    .:..||::.|:.|.|||..||:|...|:|.|||||
Mouse  2427 LDEKQEICEKMRQLDRQRDKTRQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPA 2491

  Fly  3044 LVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRY 3108
            ||||.|||||..||:.|||:|:.|||.:|. :.:|:.....:.....|.:..::|..:....:||
Mouse  2492 LVNCCTIDWFQSWPEDALEAVASRFLEDIE-MSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRY 2555

  Fly  3109 NYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKN 3173
            ||.||.|:||||:.:..||.:|....:..:.|.|.||.||.|.:.:|..:|..|:....:||:.:
Mouse  2556 NYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVAS 2620

  Fly  3174 QEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKL----CEEDFLKAQPALIAAQE 3234
            :|.|.::|::..|:.:|:|.......:|    .:..|....||.    |:.|..:|.|.|.:|..
Mouse  2621 REVDEMMIIIERESMEVAKTEKIVKADE----TVANDQAMAAKAIKDECDADLAEALPILESALA 2681

  Fly  3235 ALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKG-KIPK--------DRSWKACRAFMGNV 3290
            ||:||...::|.:||..|||..|..|..|:.:|...|. |||.        :..|...:..:|::
Mouse  2682 ALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDI 2746

  Fly  3291 DKFLDNLINYDKKHIHPDVIKAL-QPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVV 3354
             :||.:|..|||.:|.|..:..: :.||.:.:|.||||...|:||.|||.|||.::.:..|..:|
Mouse  2747 -RFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIV 2810

  Fly  3355 EPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDI 3419
            .||:..|..:|.:::.|.:.|......|.|::::|..||...:....||...:::....:..::.
Mouse  2811 APKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLER 2875

  Fly  3420 ANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKN 3484
            |.:|||||..||.||..|...|......|.|||||.|..::|:|.||..|||. |.:.|..:.| 
Mouse  2876 AEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQN-QTQEWSQSCK- 2938

  Fly  3485 SQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVK 3549
             :..||.:|.......:.:...|..||..|||||..|.:|..|::.:.|:|||||||.|..||:|
Mouse  2939 -ERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIK 3002

  Fly  3550 TKYGT-GLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIG 3611
            ....| .|.:::||..:|:..:|..:..|:.:|:||:||.:||:|.|||.:|..|:|  |.:::|
Mouse  3003 NMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLG 3067

  Fly  3612 DREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTR 3676
            |..|::...||..:.|||.||||.||...:.||:||.:|.:|::||||..||..||||||..:..
Mouse  3068 DSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQS 3132

  Fly  3677 LTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQID 3741
            |..|....|..||.:||.:|..||.:..|:|||.|.:..|..:|..|:||..|...|:.|..:||
Mouse  3133 LIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKID 3197

  Fly  3742 SAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSI 3806
            :.|..||..|..:||::|.:.||..|.|:||:||..|..:|..::..:..::.|..|::.|.|..
Mouse  3198 NTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHF 3262

  Fly  3807 TFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR------FPYMPNQTSNFTWL 3865
            |:..:|...|.|||:|||:|...|.:.:|::...:..||..|||.      .||    |:..|||
Mouse  3263 TYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPY----TNPCTWL 3323

  Fly  3866 THVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCI 3929
            ....|..|..|::...||.:.::.......|||..||..|.:|.||.:|:.| :..||:.|:||:
Mouse  3324 PQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEPHHEMFPEDWENKANDFQRMLIIRCL 3388

  Fly  3930 RPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGF 3994
            |||::...::.||.:|||..:|:....:.::.|.:|:....:.||||||.||:..:.|.....|:
Mouse  3389 RPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGY 3453

  Fly  3995 SFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSY 4058
            .  .....|:||||||..:|...:|.|.:.|.||:|||.||...|:|:|||..|. |..:.|..:
Mouse  3454 G--GSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDF 3516

  Fly  4059 RLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKA--LDNFSD-ETLEMCSKETEFK 4120
            |::|::.|:.:     .|..:|::.:|:|||.|.|:.|||.::  :|..|| |....|.|..|||
Mouse  3517 RIWLTSYPSPN-----FPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFK 3576

  Fly  4121 AILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIM 4185
            .:|:.||:|||:|.|||||||.|||..|.||..||.|||..|:.:|:....:|::.|||:.||..
Mouse  3577 KLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECN 3641

  Fly  4186 YGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGIL------KYTGYHNYIDDNLP-S 4243
            |||.:|||||||..|:.|.:|...||::.. :|  .|.:.||.      .:..|.|| ...|| .
Mouse  3642 YGGRVTDDWDRRTLRSILNKFFCTELVENP-QY--KFDSSGIYFVPPSGDHKSYINY-TKTLPLI 3702

  Fly  4244 ESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTP 4308
            .:|.::|:::||:|....:.::.||..:...|.:    |||..|.|.::::..:..|||.|.|..
Mouse  3703 PAPEVFGMNANADITKDQSETQLLFDNILLTQSQ----SSGSGTKSSDEVVNEVAGDILSKLPNN 3763

  Fly  4309 FNILELMGRVEDRSPYI----IVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVC 4369
            |::...|.|..  :.|.    .|..||..|.|.|:..::.|...:...:||.:.:|:.:|:::..
Mouse  3764 FDVEAAMRRYP--TTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSS 3826

  Fly  4370 LYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQ 4434
            :...::|..|...:|||:..|.|:.:|.:.||:.|:.|. :...|...||:|||..|:.||...|
Mouse  3827 ILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWY-EVGPPPVFWLSGFFFTQAFLTGAQQ 3890

  Fly  4435 QTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPA 4499
            ..|||...|:|.:..:.:|..  .:|...||.:|.||:|||::||.|:.|...:|::..|.|:..
Mouse  3891 NFARKFTIPIDLLGFDYEVMD--DKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDT 3953

  Fly  4500 MPVLYIKAVTQDKQDI--KNVYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGV 4553
            :||:::|..  .|.||  :..|..|:||...|..|         ||....|.|.:....|...||
Mouse  3954 VPVMWLKPC--KKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGV 4016

  Fly  4554 CLLLQ 4558
            .||.|
Mouse  4017 ALLCQ 4021

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 60/328 (18%)
DHC_N2 1368..1770 CDD:285579 115/414 (28%)
P-loop_NTPase 1903..2132 CDD:304359 137/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 51/142 (36%)
P-loop_NTPase 2510..2783 CDD:304359 91/279 (33%)
P-loop_NTPase 2860..3127 CDD:304359 108/272 (40%)
MT 3140..3480 CDD:289543 115/354 (32%)
AAA_9 3509..3722 CDD:289547 93/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 244/712 (34%)
Dnah7bNP_001355646.1 DHC_N2 763..1162 CDD:337038 120/532 (23%)
DYN1 797..3666 CDD:227570 1040/2923 (36%)
AAA_9 2963..3179 CDD:338486 93/216 (43%)
Dynein_heavy 3320..4019 CDD:335192 248/721 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.