DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah8

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_008773178.1 Gene:Dnah8 RGDID:619986 Length:4690 Species:Rattus norvegicus

Alignment Length:4823 Identity:1358/4824 (28%)
Similarity:2302/4824 (48%) Gaps:569/4824 (12%)


  Fly     7 KKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGG----- 66
            ::..:|...::.:..|.:.:.|.|....::|......|....|......|.:.|....|.     
  Rat   160 RRMKIDPSYKYIFEILGEKLGLDLVSVEELILDCPSLDAFSSFFEKGGSKTLKFLYQEGDVPGLG 224

  Fly    67 -------------QLYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLL--IGDLLPNPLANL 116
                         :||...:.|.:.:....:|:|....:.:..:.:...:|  :.|.....|..:
  Rat   225 KDVSGVPKGGKMMRLYIDNAAPEKLKELCLFFVRCRNDVAINSKTIYEDVLFTVLDASKGLLKGI 289

  Fly   117 SILCDEVFFPLLNNTVNQVGWTNVIANDMKTESQE-------------MRNGIAQMKGLVINRTI 168
            ..:...:|.|.:..|.|   | ..:....:.||::             :......::|.|:.:.:
  Rat   290 KNMLKNIFLPAILATGN---W-GALNQSKQGESEKHIFTETINRYLLFLDGATISIEGTVMLKKV 350

  Fly   169 ----FPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKEN 229
                |......:||..||.:..          |.|.||.:::.|...:|.::......:..:.::
  Rat   351 DNIDFSKLHTFEEVTAAASSSE----------MVHQLEDVLMMWYKQIEQVLIESEQMRKEADDS 405

  Fly   230 FPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDI 294
            .||.|  ...|:........:.||:.....|.:..||....|....::|.:...:.::..|::|.
  Rat   406 GPLTE--LEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDN 468

  Fly   295 TKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVN 359
            .:.|..|::........|:......|:.|:..|.::...|||::|...||..|....|.::....
  Rat   469 VRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACK 533

  Fly   360 RTVE---PDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNSL------KKFKIGTTFNSQDWT 415
            ..:.   .:.::..:.....||:...:...:.|:..:::.|..:      |.|::...:      
  Rat   534 AYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMY------ 592

  Fly   416 WHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWT 480
                 |||:.:.|..|||::.::...|:.:..|....:.|:....|.|         .:||:...
  Rat   593 -----IFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKF---------KNIYQGIK 643

  Fly   481 NIQYNPIDPDAENSLFQRDRLSFKAKTDVME----RMVSFQFEKGL--EDTHDLLLAGSLLLRPI 539
            ..||:.:||  ..:.|..|...|..|.:.:|    ..::..|.|.|  :....||.....|..|.
  Rat   644 KNQYDILDP--RRTEFDTDFSDFMGKINTLEIQIQAFMNITFGKILSSQQALQLLQRFQKLNMPC 706

  Fly   540 IKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRI 604
            ::..:...:..|:..:..|:...||.:.:.|        ::.|.....|.::|.|.::::|..||
  Rat   707 LQLEINHTIERILQCYVAELEATKKLYHSQK--------DDPPLARNMPPIAGKILWVRQLYRRI 763

  Fly   605 IGLHKEHELYEYPLFDNERGGYVSDIFN-----IMVQEIDDFTKMLLD-------KWTVECWQGI 657
                  :|...| .|.|      |||.:     .::::.:..:.:|::       .|..|..| :
  Rat   764 ------NEPINY-FFKN------SDILSSIEGKAVIRQYNKISYVLVEFEVVYHTAWVKEISQ-L 814

  Fly   658 QQDITLTL-IEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLM 721
            |..:..|| :...|..:|.|||..:::..:::.|.:..:..||.....|....|.:|...::.|.
  Rat   815 QYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKKLLKLESKLKADKLYLQ 879

  Fly   722 RIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFS--------QRFIVMIFKMVK 778
            .:.::|:|..:........|:..:|..:|..::..|..:.|::..        :..:.|..:::|
  Rat   880 GLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLK 944

  Fly   779 YLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDL 843
            .::|   ..:.:::.:.:.|   .|..|....|.....:      |.:|::   |...|:...|:
  Rat   945 KVND---LCEMHIDTVLKEI---AKTLLISLSDSGATRV------EDMLTL---NETYTKEWADI 994

  Fly   844 LMYVN---------LKLFFD--IPRRYSLPPGE----------HGEEDEESDGI-WPPIISLSVM 886
            |.:.:         |.|.|:  ...:|:..|.:          .|.|.:|.:.: :.|       
  Rat   995 LNHKSRHVEEAVKELILIFEQIYEVKYTGKPAKPVPEQRKHVVFGSEADEGESLEYDP------- 1052

  Fly   887 TSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALF--REYEIYVDEI 949
                 ......:|..|..:||::|..|     :..|..::||..|.:..|...  .:..|:|...
  Rat  1053 -----DSTARDVDNNDKEDEFKKECKE-----VYAFFSHQLLDSLQKATRLSLDTMKKRIFVGNQ 1107

  Fly   950 IAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLD---------------- 998
            ..:...|.|    ::::.||               .|..||||...:||                
  Rat  1108 GRKRSEDVV----SFIKTEV---------------HLAIPNVVMVPSLDDIQQAINRMIQLTLEV 1153

  Fly   999 -------------------TSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTE-VTNMNPYSFYD 1043
                               |||:..         |..:.|...||:..:...| :......:||.
  Rat  1154 SRGVAHWGQQQVRRTKSPQTSSRGS---------DQPSIMGKALKKEERSFEESIPARKLKNFYP 1209

  Fly  1044 ELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKF-GRNLTLDERD 1107
            .:.:..::.|..:.:.:.:....:|.....:.|.::.:||..|:..   :||:| ..|.:|.|..
  Rat  1210 GVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWTEDRDV---KVKEFLANNPSLTEIR 1271

  Fly  1108 AEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQ 1172
            :|.            |.|.......|:|...|::.              .|.|:....|:|:..:
  Rat  1272 SEI------------LHYATFEQEIEELKPIIDVG--------------ALELHTEPMKLALSIE 1310

  Fly  1173 VGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDS 1237
            ...|..|....|....|..:.::..|::|  .:.|:.....|.:.:...:..|:.|.:.:...|.
  Rat  1311 AKAWKMLLCRYLNEEYKKKMSDMIVFINE--YLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDM 1373

  Fly  1238 MFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQS-------YQVDL 1295
            ...|::|...:|.::..|....|...::.|..::.|::..|.:.:..:..:|.       ..||:
  Rat  1374 TLGPIEEAYGILNRFEVEVTKEESEGVDTLRYSFNKLQSKAVSVQDELVQVQPKFKSSLLESVDV 1438

  Fly  1296 IEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAV---LFEL 1357
            ..:.::   |....|..:..     .||.:...|..:...:.....::..|.....:.   ||.|
  Rat  1439 FREDVI---NFTEAYETEGP-----MVPNIPPQEASNRLQIFQANFDDLWRKFVTYSAGEQLFGL 1495

  Fly  1358 QGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKA 1422
            ...|...:...|.:|.|::.::....|:..:|:.:.:..|..:|||.::.|..:|....|.|.|.
  Rat  1496 PVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKG 1560

  Fly  1423 MRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD-DSTTLKDLIDLNL 1486
            ::.|:.::.::..:.:...|...:..:.|.|::.|||..:.:.|...|.:: |:..|:::::..|
  Rat  1561 LKDWQAYLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPL 1625

  Fly  1487 HEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQ 1551
                  :||..|..|.|:.::               ||:            |.|:|..:||....
  Rat  1626 ------LKNKDDIEVSELLLK---------------GTE------------SGEIITLMEDSLMV 1657

  Fly  1552 LQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRF 1616
            |.::.|::|...|:..::.|..:||.:..||..|..||..|.|||::|:|. ||..|||::::||
  Rat  1658 LGSLLSNRYNTPFKKTIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGG-DIAKQLPQEAKRF 1721

  Fly  1617 DYIDKEFKALLAQMNADRNVVRST--NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRF 1679
            ..|||.:..::.:.:.:.||:...  :.:..:|..||.   :.|.:|:|:|..|||.|||.:|||
  Rat  1722 QNIDKSWVKIMQRAHENPNVISCCVGDETMGQLLPHLH---EQLEVCQKSLTGYLEKKRLLFPRF 1783

  Fly  1680 YFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL-ISGSKNAAGMVAKELEEYV---PFLEN 1740
            :|||...||:||...::...:..||..:.|::.::.. .........::::|.|:.:   |.:  
  Rat  1784 FFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHPKDYDRMTAVISREGEKIMLDTPVM-- 1846

  Fly  1741 CDCSGKVEVWLNRITDKMRDTLRDQLKRS-----------LTFYDHKPRHVWIFEWPAQPALVGT 1794
              ..|.||:||..:......:|.:.::.:           |.|.:|         :|||..|:|.
  Rat  1847 --AKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNH---------FPAQVGLLGI 1900

  Fly  1795 QIMWTTETNDAFAKVQQRYENALKD-------YNKKQITQLNNLIILLLGDLTAAERQKIMTICT 1852
            |::||.::.:|.        |:.||       .|:|.:..||.||.....|||..:|.|..|:.|
  Rat  1901 QMLWTHDSEEAL--------NSAKDDRKIMHITNQKFLDILNTLISQTTHDLTKFDRVKFETLIT 1957

  Fly  1853 IDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVIT 1917
            |.||.||:...::...::..|.|:|..|.|..:...:|....:|.|..|.|..|:||.|.|||||
  Rat  1958 IHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFNYQNEFLGCTDRLVIT 2022

  Fly  1918 PLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKG 1982
            ||||||||||.|:|.:.|||||||||||||||||||:||.||..|.|||||:|||::.:|.|.||
  Rat  2023 PLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKG 2087

  Fly  1983 LAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFL-GEHIALRTTVGVFITMNPG 2046
            |||:|:||||||||||.:.||||.|.|:..:..|.|.:|:.|.|. |:.:.|....|:|:|||||
  Rat  2088 LAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPG 2152

  Fly  2047 YAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHY 2111
            ||||.|||||||..:|..||:|||..:|..:.|.:.||.|..:||:||..||.||:|.|:||.||
  Rat  2153 YAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHY 2217

  Fly  2112 DWGLRAIKSVLVVAGALRRDDRQRPEDQVL---MRALRDFNIPKIVTDDVPVFMGLIGDLFPALD 2173
            |:|||.|.|||...|:.:   |.||||..|   ||.|||.|:.|:|.:|.|:|:.||.||||.|.
  Rat  2218 DFGLRNILSVLRTLGSQK---RARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQ 2279

  Fly  2174 VPRKRNPEFEAVIKRSALDLKLQPEDGFI------LKIVQLEELFAVRHSVFIIGFAGTGKSEVW 2232
            :......|.:|     |:|.::..| |.|      ||:|||.|...|||.:..:|.:|:||:.|.
  Rat  2280 LDSNTYAELQA-----AVDNQVNLE-GLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVI 2338

  Fly  2233 KTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVL 2297
            ..|.|:.....|......:||||:|..::||.::.:|.:|.||:||.|.|...........:::|
  Rat  2339 TILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLIL 2403

  Fly  2298 DGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQD 2362
            ||.:|.:|||:||:|:||||.||||:.:||.:....:||||:.::..|:||||||.|::||:...
  Rat  2404 DGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSA 2468

  Fly  2363 LGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSML 2427
            |.|.|.:|:||..||.....:.|: |:||.........:..|.....:.:...:..:..||:.::
  Rat  2469 LSWRPILQAWLKRRTQQEATAFLS-LYDKVFEDAYTYMKLNLIPKMQLLECNYITQSLNLLEGLI 2532

  Fly  2428 TPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKA-VKFP-----LSG 2486
            ..:........|.....|||.::|..|:.|..:     |.|..:.||..::: :..|     ...
  Rat  2533 PSKEEGGVSSVDHLHKLFVFGLMWSLGALLELE-----SREKLEVFLRGHESKLNLPEIAKDSHH 2592

  Fly  2487 TIFSFYI------DHETKKFFPW---TNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEAD 2542
            |::.||:      :|..|:..|:   |:.:|::        .|.||...:..|..|.:||:.:..
  Rat  2593 TMYEFYVTDYGDWEHWNKRLQPYFYPTDSIPEY--------SSILVPNVDNIRTNFLIDTIAKQH 2649

  Fly  2543 HPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIG 2607
            ..::|.|..|:.||:::.|.|.....:.....::.|:..|...|.||.:|..::|:.|..|||.|
  Rat  2650 KAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPG 2714

  Fly  2608 NKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK----MTLRDIHKCNIVACMNPSA 2668
            .::|..|:||:|||.::::.....:.::||.|:....|...|    .|:.|:..  |.|.::|..
  Rat  2715 GRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQL--IAAMIHPGG 2777

  Fly  2669 GSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHL 2733
            |...|..||:|.|..|....||..::..|...|...:.| |.:||...:..:..|:|:....|..
  Rat  2778 GRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFD-PCRKFRPEICDMIGNLVSVGRVLWQ 2841

  Fly  2734 KVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDI 2798
            ......|||..||||.|||||::.|:.|:|...:|.|.....::.|:.|||.||..|:.:...|.
  Rat  2842 WTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECKTIPILMALFKHECNRVIADRFITPDDE 2906

  Fly  2799 NSFKKIVSDIVRKGIEGVNDDV---VYAQPLIYCHFAKGLTDIK-----------------YMPI 2843
            ..|.   :.::|...|.::.:|   :..:|    :|...|.|:.                 |..:
  Rat  2907 QWFN---TQLIRAVEENISPEVAASINPEP----YFVDFLRDMPEPTGDEPEDTMFEVPKIYELV 2964

  Fly  2844 SGWDRLKSLLDEAQDRYNDYI--GAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSL 2906
            ..::.|...|...|.::|:.|  .:::||.|.|||:|:.:||||:.:|.|.|||:||||||||||
  Rat  2965 PSFEFLCEKLQFYQKQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSL 3029

  Fly  2907 TRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDL 2971
            :||||||:...:|||.||:.|:||:|..::..||..||.......|:.||:|:..|.||..:|:|
  Rat  3030 SRLASFIAGYQIFQITLTRSYNVSNLIDDLKNLYKVAGADGKGITFIFTDNEIKDEAFLEYLNNL 3094

  Fly  2972 LASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRE---------NCWKYFIEKVRSLLKVVLCF 3027
            |:||:|..||..||::.|...:.:.:|       ||         |.::|||.:.|..|.|||||
  Rat  3095 LSSGEISNLFARDELDEITQGLISVMK-------RELPRHPPTFDNLYEYFISRSRRNLHVVLCF 3152

  Fly  3028 SPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVL-PKELALPVSNFMAFVH 3091
            ||||...|.||.|||.|::..|:|||..||::||.:|:..|||:..:: ..|:...|...|...|
  Rat  3153 SPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLSDYNIVCSMEIKRHVVEAMGLFH 3217

  Fly  3092 KTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVD 3156
            ..|::..:.|....:|..:.||||:|..|..|..:..||||...::..|:..||.||...::.|.
  Rat  3218 DMVSESCENYFQRYRRRAHVTPKSYLSFINGYKNIYTEKVKYINEQAERMNIGLDKLMEASESVA 3282

  Fly  3157 ALQDVLKVQEVELKIKNQEADNL---IIVVGTENEKVSKE-RAFASKEEKNVRQIE-EDVTAKAK 3216
            .|...|.|:|.||.:.:.:||.:   :.|....:.||..| :....|.:|.|.:|: |.|.|::|
  Rat  3283 KLSQDLAVKEKELAVASVKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAESK 3347

  Fly  3217 LCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK-GKIPKDRSW 3280
            |     ..|:|||..|:.||||:..|::..::....||..::.:...||:||..| ..:..|...
  Rat  3348 L-----EAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEK 3407

  Fly  3281 KACRAFMGNVDK------FLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCS 3339
            ..|:...|...|      ||.:|..:.|..|:.:.::.||||....:::.|.........|||.|
  Rat  3408 PCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTYESAKKVCGNVAGLLS 3472

  Fly  3340 WVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQ 3404
            |.:.:..||.:...|.|.:..|.:.|..:..|..:|......|.|.:.:|:.:|.::|.|:.:|.
  Rat  3473 WTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKM 3537

  Fly  3405 KCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAY 3469
            ...::|......:..|:.||.||:.||:||.:..|.....|.:|.||:|:.:.|:||:|.|.:.:
  Rat  3538 DLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKAQINRLVGDVLLCTGFLSYLGPFNQIF 3602

  Fly  3470 RQELQEKLW---MPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQS 3531
            |..|.:..|   |.|.|     ||.|:.::...|:.|...|.||..||||.|.:|.:|..|:.::
  Rat  3603 RNYLLKDQWELEMKARK-----IPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKA 3662

  Fly  3532 ERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNP 3595
            .||||:||||.||..|:|:| ....|.|..|:.:.:...:|.::|.|..||||:|.|.:||.|:.
  Rat  3663 TRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDN 3727

  Fly  3596 LLGRQLIKKGTV--LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQL 3658
            :|.:..||.||.  :|:||:|.|....|:|.:.|||.||.:.||:.|:|::|:||||..|||:||
  Rat  3728 VLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQL 3792

  Fly  3659 LAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTA 3723
            |..|:..|:.:||:.|.:|.:.....|..:|.|||:||.:||:...::::|.:|:..|..||:||
  Rat  3793 LRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSTTQGSLVDDESLIGVLRITKQTA 3857

  Fly  3724 DEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLK 3788
            .|:..|:..|..|.::|::|:|.:||||.|.||:||::.::..:|.:||.||..|..:|:.:|.:
  Rat  3858 AEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMAR 3922

  Fly  3789 AMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR-- 3851
            :..:...:.|:.|:|:.:|:..|.|:.|||:|..|.:|...:.::|.:..|.|:..|...|::  
  Rat  3923 SEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFALLMTLKIDLQRGTVKHKEFQALIKGG 3987

  Fly  3852 -------FPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEK 3909
                   .|..|     |.|:..:.|..:..|:....|..:...|..:.|.||.:.|.::||.|.
  Rat  3988 AALDLKACPPKP-----FRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEI 4047

  Fly  3910 FPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFF 3973
            .|..:... ...::|.::|...|||..:..|.:|.:.|..||.:...:...:|:|||...|.:..
  Rat  4048 IPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLIC 4112

  Fly  3974 VLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVAR 4038
            .||.|.||...::.|.|.|..     ...::|:|||||:.|...::::.|.|.||:|||.||   
  Rat  4113 FLSMGSDPTIQIDALAKKLKL-----ECRTISMGQGQEVHARKLVQLSMQQGGWVLLQNCHL--- 4169

  Fly  4039 WLPSLEKKMESSL--SNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKA 4101
            .|..:|:.:|:.:  .....|:|::::.||...     .|..:|::::|.|||||.|:.|.:.:.
  Rat  4170 GLEFMEELLETLMVTETTEDSFRVWITTEPHDR-----FPITLLQTSLKFTNEPPQGVRAGLKRT 4229

  Fly  4102 LDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL 4166
            ....:.:.|:: |....:|.:|:::.:.|:.|.|||||||.|||..|.||..|.:.||..:.|:|
  Rat  4230 FAGINQDLLDI-SNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHL 4293

  Fly  4167 ---EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGIL 4228
               :....|.|..:||:.||:.|||.:|||:|:||...:...:...::.:....:..|:..|...
  Rat  4294 DECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPVCK 4358

  Fly  4229 KYTGYHNYIDDNLPS-ESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQED 4292
            ....|..|| .:||| ::|.::|||.||:|.:.:..:..:...:..:||:.:||.. |||  :|.
  Rat  4359 TLDQYFEYI-QSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGM-GET--REA 4419

  Fly  4293 IIKNIIEDILDKTPTPFNILEL------MGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDL 4351
            |:..:.||:|.|.|..:...|:      ||.:...:   |...||.:||..:::.|:.|||:|.|
  Rat  4420 IVYRLSEDMLSKLPPNYVAHEVKARLMKMGHLNSMN---IFLRQEIDRMQRVISLLRNSLNDLKL 4481

  Fly  4352 GLKGELTISSVMEDLMVCLYMDQVPEQWTKLAY-PSMLGLQSWFSDLMLRLRELEGWVADFRMPS 4415
            .::|.:.:|..:.|.:..:|..::|:.|.:::: .|.||.  ||::|:.|..:...|:.:.| |:
  Rat  4482 AIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGF--WFTELLERNAQFSTWIFEGR-PN 4543

  Fly  4416 SIWLAGFFNPQSLLTAIMQQTARKNE-WPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGA 4479
            ..|:.||||||..|||:.|:..|.:: |.||.:.::.:|.::.|||:.|.|.||.||.||:|:||
  Rat  4544 VFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVTIHNEVLRQTKEEIITPPVEGVYIYGLYMDGA 4608

  Fly  4480 RWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVY-KIRLRGPTFVWTFNLKSRE 4543
            .||.:.|.:.::..|.||..:|||:|.|:.........:|.||:| |.|....||:....|::..
  Rat  4609 SWDRRNGKLTESTPKVLFMQLPVLHIYAINSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVL 4673

  Fly  4544 RASKWTLAGVCLL 4556
            ....|.|.||.||
  Rat  4674 SPDHWILRGVALL 4686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 114/594 (19%)
DHC_N2 1368..1770 CDD:285579 103/420 (25%)
P-loop_NTPase 1903..2132 CDD:304359 137/230 (60%)
P-loop_NTPase 2217..2352 CDD:304359 53/135 (39%)
P-loop_NTPase 2510..2783 CDD:304359 80/277 (29%)
P-loop_NTPase 2860..3127 CDD:304359 116/279 (42%)
MT 3140..3480 CDD:289543 103/355 (29%)
AAA_9 3509..3722 CDD:289547 90/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 218/701 (31%)
Dnah8XP_008773178.1 DHC_N1 372..928 CDD:285571 114/612 (19%)
DYN1 1326..4338 CDD:227570 1016/3149 (32%)
DHC_N2 1506..1874 CDD:285579 103/409 (25%)
P-loop_NTPase 2008..2239 CDD:304359 139/234 (59%)
P-loop_NTPase 2323..2459 CDD:304359 54/136 (40%)
P-loop_NTPase 2627..2891 CDD:304359 80/267 (30%)
P-loop_NTPase 2981..3252 CDD:304359 116/278 (42%)
MT 3265..3611 CDD:289543 101/351 (29%)
AAA_9 3640..3856 CDD:289547 90/216 (42%)
Dynein_heavy 3997..4679 CDD:281078 220/711 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.