DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH12

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001352957.1 Gene:DNAH12 HGNCID:2943 Length:3960 Species:Homo sapiens

Alignment Length:3884 Identity:1261/3885 (32%)
Similarity:2005/3885 (52%) Gaps:394/3885 (10%)


  Fly   903 DLEEFEEE---QSESEEE---------IITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLV 955
            |.|..:.:   |:.:.||         :|..|.:.|.|:|:..|:...|  |.. |..:::..|.
Human   240 DCESLKTDLSIQTRNAEEKIMNTWYPKVINLFTKKEALEGVKPEKLDAF--YSC-VSTLMSNQLK 301

  Fly   956 DSV-ITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNM 1019
            |.: .|...:::: .|.:.:...|||:|.:...:..:.::               .|..|..:|:
Human   302 DLLRRTVEGFVKL-FDPKDQQRLPIFKIELTFDDDKMEFY---------------PTFQDLEDNV 350

  Fly  1020 MSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVE-----IMNKIKLA----LQAVRVHGKG 1075
            :||::|:|:....|..:.  |:.........||.:..|     .::.:|.|    |:..|.|.:.
Human   351 LSLVERIAEALQNVQTIP--SWLSGTSTPVNLDTELPEHVLHWAVDTLKAAVHRNLEGARKHYET 413

  Fly  1076 FMEFSSLWIWDKSTYLSEVKKF-GRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFI 1139
            ::|..: |:.| .|.:..::.| ..:.|.||                         |.|.::||:
Human   414 YVEKYN-WLLD-GTAVENIETFQTEDHTFDE-------------------------YTEFIEKFL 451

  Fly  1140 ELQDQIR---TWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDE 1201
            .|..:|.   .|..|    ..:||:....|..:.::...:.::...|:.::.:   ||.:....|
Human   452 SLASEIMLLPQWIHY----TMVRLDCEDLKTGLTNKAKAFANILLNDIASKYR---KENECICSE 509

  Fly  1202 ANIV----LKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELA 1262
            ...:    ||:....::...|:..:.....:..::.|.        .|.:..||.:| |.|..| 
Human   510 FEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELIL--------RIQESKRQMSY-FLDVFL- 564

  Fly  1263 QINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFL------SKKFFF 1321
                .|...:.:........:.|.||.....:|||......:|.....|:|.:      |::.  
Human   565 ----FPQEDLALNATVLMWPRKINPIFDENDELIENAKHKKENELMAKREKLILEIEKESRRM-- 623

  Fly  1322 VPCLSCYELIDESDLE-----LVALEERQRSLAES--AVLFELQGPDPVKIELCRF-DLKLVKI- 1377
                  .|..:.::||     :..:.:.|:.:.||  ||.|..:..:..|.||.:: :|..:|: 
Human   624 ------EEFTEFAELERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELDKLKVN 682

  Fly  1378 ------MWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGREL-------------------- 1416
                  .::|.:..|.:...|....:..::.|:|:.:.::|.||:                    
Human   683 IEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEKRK 747

  Fly  1417 ----RGLDKAMRTWEP---------FIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKV 1468
                |.|::.....||         ...|| .:|.....:..|:.|.||.:|.|||.::.:....
Human   748 AARKRSLEEEKIEEEPKDNATITMCSTVME-QIKAFKEYIPTVSILCNPGMRARHWKQISEIVGY 811

  Fly  1469 KFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIK 1533
            ..:.|..|||:.::.|||..|.|:.:.|...:.||.::||.:..:...|..:.|...::..|.:.
Human   812 DLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDTGVC 876

  Fly  1534 LLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESI 1598
            :|.:.:|:...|:|...:.|.|..|.:|..||||::.|::||....:.|..|.:||.:|.|||.|
Human   877 ILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPI 941

  Fly  1599 FIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG--SKLYEHLEILLKMLLLC 1661
            |. ||||..|:||:.|:|..:|:.::.::.....|..|:.:|:.:|  .||....|:|.|::   
Human   942 FC-SEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIM--- 1002

  Fly  1662 EKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGM 1726
             |.||.|||.|||.:|||:|:|:.::|:|||...:|..|..||.|.::.:.||..:. :.:...|
Human  1003 -KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLP-NLDIKAM 1065

  Fly  1727 VAKELE--EYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQP 1789
            .:.|.|  |.:..:......|.||.||.::.|.|..::.|.:..:...|....|..|:.|||.|.
Human  1066 YSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQV 1130

  Fly  1790 ALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTID 1854
            .|..:|:.||:||.:..:...:    .||.|.|:...|||.::.|:.|.|:...|..:..:.|||
Human  1131 VLCISQMFWTSETQEVISGGTE----GLKKYYKELQNQLNEIVELVRGKLSKQTRTTLGALVTID 1191

  Fly  1855 VHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPL 1919
            ||:||||..:|...|...|.|.|.:|||:.|:.  ::....|.:...:|.||||||:||||||||
Human  1192 VHARDVVMDMIKMGVSHDTDFLWLAQLRYYWEN--ENARVRIINCNVKYAYEYLGNSPRLVITPL 1254

  Fly  1920 TDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLA 1984
            |||||.||..:.:|.:||||.||||||||||||||.:||.:...|||||:.:||.::|...||||
Human  1255 TDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLA 1319

  Fly  1985 QTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAG 2049
            .:|||.||||||||.:|||||||.|:.|||.||:.|...|.|.|..:.|.....|.|||||||||
Human  1320 SSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAG 1384

  Fly  2050 RAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWG 2114
            |:|||:|||.|:|..||:||::|||:||.|.:.||..||.|:.|.:..|.||.|.||.|.|||:|
Human  1385 RSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYG 1449

  Fly  2115 LRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRN 2179
            :||:|:|||.||.|:.......||.:|:|:::|.|.||.::.|:|:|.|:..||||.:.:|....
Human  1450 MRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADY 1514

  Fly  2180 PEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTL-------NK 2237
            .||......:.....|||...|:.||:|..|:..|||...::|.....|::|...|       |:
Human  1515 HEFLECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNE 1579

  Fly  2238 TYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDID 2302
            ....::.|..|..:|||::|..:|||..:|.:.||.||:.:...|:.|.......||:|.||.||
Human  1580 HGYGEEEKVIYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPID 1644

  Fly  2303 PMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTP 2367
            .:||||:|||:||||.|.|.|.|.|.::.:|.|:||...|..|:||||||.|::|:.|..|||.|
Human  1645 TLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEP 1709

  Fly  2368 FIQSWL----GTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISD------IARL--QMTC 2420
            .:.|||    |........::|..||...:||.|:..:.:.:.:.|.|:      :.||  .:.|
Human  1710 LVSSWLNSLKGPLCEPEYQALLRGLFAWLIPPSLNQRKKKCKELIPTSNSNVVVSLTRLFEVLLC 1774

  Fly  2421 YLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQD--QIIDW---------------SNE 2468
            .::::..|.:::     :.|....|:|.::|..|.|...|  ::.|.               .:.
Human  1775 NVVENDPTSKHI-----RVWIMACFIFSLIWSIGGSCDTDGRRVFDTFIRLIILGKDDENPVPDS 1834

  Fly  2469 FSKWFLNEYKAVKFPLSGTIFSFYIDHETK-KFFPWTNLVPQFEL-DMDLPLQSNLVNTAETTRL 2531
            ..||      ...|...|.::.:..:.:.| ::..|..|:....| |..:.:|..:|.|.:|.|.
Human  1835 VGKW------ECPFDEKGLVYDYMYELKNKGRWVHWNELIKNTNLGDKQIKIQDIIVPTMDTIRY 1893

  Fly  2532 RFFMDTLIEADHPLMLIGPSGSGKTILMNAKL-SALPSDKYSVTNVPFNFY------TTSEMLQR 2589
            .|.||..|....||:.:||:|:||::.:..|| :.|..|:|      |.||      |::..:|.
Human  1894 TFLMDLSITYAKPLLFVGPTGTGKSVYVKDKLMNHLEKDQY------FPFYINLSARTSANQVQN 1952

  Fly  2590 ILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWY---DRQKMT 2651
            |:...|:|:....:||...|:.|.|:||||||.::||....|..|:|||.|..|||   |..|:|
Human  1953 IIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKIT 2017

  Fly  2652 LRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDK 2715
            |.||   .::|.|.|..|... :.||..|||...::|..|.:.:..|.:||::.::..  .:|..
Human  2018 LVDI---ELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYLRT--HEFPP 2077

  Fly  2716 AVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLW 2780
            ....:...:|...:.::.:.|.:.|||..|.||.|||||.:.:..|.|....:...|.:.||||:
Human  2078 EYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVANKHTMIRLF 2142

  Fly  2781 IHECYRVYGDKLVDYTD----------------INSFKKIVS--------------------DIV 2809
            :||..||:.|:|::..|                ..||..|.|                    |.:
Human  2143 VHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFHSIFSHLRKQNAPVTEEDLRNLMFGDYM 2207

  Fly  2810 RKGIEGVNDDVVYAQ-PLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYND-YIGAMNLVLF 2872
            ...:||  ||.||.: |.|: ||:                  .::|:..|.||. :...||||:|
Human  2208 NPDLEG--DDRVYIEIPNIH-HFS------------------DVVDQCLDEYNQTHKTRMNLVIF 2251

  Fly  2873 DDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIA 2937
            ...:.|:.||.|:|:.|.|.|||:|:||||:|||||||:.::.:.:||.:::|.|.:::.:.::.
Human  2252 RYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMK 2316

  Fly  2938 TLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGI 3002
            .|....|:|.....||:||:::..|.||..::.:|.:|::..:|..||.:.::..|| .|.|.| 
Human  2317 GLLRNVGMKGQKTVFLITDTQIKEEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVR-PVAQAG- 2379

  Fly  3003 VDNREN------CWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQAL 3061
              |:.:      .:.:|:.:.:..|.||:.|||:|...|.|.|:||:|:||.|||||..||:.||
Human  2380 --NKHDELSPLALFAFFVNRCKDNLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQSWPEDAL 2442

  Fly  3062 ESVSLRFLS--EITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYS 3124
            |.|:::||.  |:|.:.::..:|:....   |.::.|:|:.:|....|:||.|..|:||||..:.
Human  2443 ERVAVKFLETLELTEVEQQEIVPICKHF---HTSIMDLSERFLHELGRHNYVTATSYLELIGSFR 2504

  Fly  3125 KLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEAD----NLIIVVGT 3185
            :||.:|.:|.::.:.|..|||.|||....:|..:|    ::.|||:.|.:||.    |::.|:..
Human  2505 QLLTQKRQAVMEAKQRYMNGLDKLAFAESQVGEMQ----MELVELQPKLEEAKIENANMMQVIEI 2565

  Fly  3186 ENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSF 3250
            |:.:|..:|.|...:|:......|:..|....||.|..:|.|||.||..||:||...::|.:||.
Human  2566 ESVQVEAKRQFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSM 2630

  Fly  3251 GSPPDAVVSVCGAVLVLFSSKGKIPKDRS---------WKACRAFMGNVDKFLDNLINYDKKHIH 3306
            .:||..|..|..||.|:...|.:...|.|         |...:..:|::: ||.:|..|||.:|.
Human  2631 KNPPSGVKLVMAAVCVMKDIKPEKISDPSGTGGKILDYWGPSKKLLGDMN-FLRDLKEYDKDNIP 2694

  Fly  3307 PDVIKALQ-PYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKD 3370
            ..|::.:: .|:::.||.|.|:...||||.|||.|::.:..:..|..||.||:..|.|::|.:.:
Human  2695 VTVMQKIRSEYLMNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLSEAQKSLAE 2759

  Fly  3371 ARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWM 3435
            ..:.|......|.|:|..|..|||.:.|...:|...:|:....|..::.|::|||||..||.||.
Human  2760 TMELLNQKRAELAEVEHHLENLQMTFLEKTEEKAALEDQVELCAKKLERASQLIGGLGGEKSRWA 2824

  Fly  3436 ESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEM 3500
            ::...|....:.|.||:|:.:..|:|:|.||..:||.. .|.|....|..:  ||.::.....:.
Human  2825 QAADDLQITYENLTGDVLVSAGVIAYLGAFTSGFRQTC-TKDWSMLCKKKK--IPCSEEFLLSKT 2886

  Fly  3501 ICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVK-TKYGTGLVVLRLSQR 3564
            :.|..:|..||..|||:|..|.:|..|:....|:|||||||.|..||:| ::....|.|::||..
Human  2887 LGDPVKIRAWNIAGLPTDTFSIDNGVIVNNCRRWPLMIDPQGQANKWIKNSEKENQLSVIKLSDS 2951

  Fly  3565 NYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRLILHT 3627
            :|:..:|..:..|:.||:||:||.:||.|.|||.||..|:|.:  :::|:..|:::..|:..:.|
Human  2952 DYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITT 3016

  Fly  3628 KLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLE 3692
            ||.||||.||:..:.:|:||.:|.:|||||||..||..|||:||..|..|..|....|..||.:|
Human  3017 KLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIE 3081

  Fly  3693 DDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASII 3757
            ..:|..|||:..|:|||.:.:..|:..|..::||..|...|:.|.::|..:||.|||.|:.:|::
Human  3082 KKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQIAEKTELKIAESREGYRPIAKHSSVL 3146

  Fly  3758 YFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQD 3822
            :|.:.||..|:|:||:||..|..::.|::..:..::.|:.|:..|.|..|:..:....|.|||:|
Human  3147 FFSIADLANIDPMYQYSLTWFVNLYINSIHDSNKSKILEKRLRYLNDHFTYNLYCNICRSLFEKD 3211

  Fly  3823 KLIFLTQLCIQILVNLGEVEPTELDFLLRFPY---MPNQTSNFTWLTHVGWGGIRALNNQAVFKG 3884
            ||:|...||..:|:...|:|..||.|||....   ...:..:.|||....|..|...:....|:|
Human  3212 KLLFSFLLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRG 3276

  Fly  3885 LEKDIEGSHKRWKKFVDSESPENEKFPGEW-KGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGS 3948
            |.:........|::..||:.|.|.|||... |..:.:|::.|:||:|||:::.|:.:::.:|||.
Human  3277 LRQHFCEHIYEWREIYDSKEPHNAKFPAPMDKNLNELQKIIILRCLRPDKITPAITNYVTDKLGK 3341

  Fly  3949 KYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIV 4013
            |:::....:.::::.:|:....:.||||||.||:..:.|.....  |.....|.::||||||..:
Human  3342 KFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDK--SMSGNKFQAISLGQGQGPI 3404

  Fly  4014 AENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNV-HTSYRLFLSAEPAGDPAAHILPQ 4077
            |...|:.|.:.|.||.|||.||...|:|.|||..|...|.. ::|:||:|::.|:..     .|.
Human  3405 AAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICEDFTSETCNSSFRLWLTSYPSSK-----FPV 3464

  Fly  4078 GILESAIKITNEPPTGMMANIHKA--LDNFSD-ETLEMC-SKETEFKAILFSLCYFHAVVAERRK 4138
            .||::.:|:|||||||:..|:.::  .|..|| |..:.| .||..::.:||.:|:|||:|.||:|
Human  3465 TILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKK 3529

  Fly  4139 FGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYL 4203
            |||.|||..|.||..||.||:..|..::.....:|:|.:.||.||..|||.:||||||||..|.|
Human  3530 FGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTML 3594

  Fly  4204 EEFMQPELIDG---ELEYCQGFPAPGILKYTGYHNYIDDNLP-SESPSLYGLHSNAEIGFLTTVS 4264
            .:|....:::.   :......:.||....|..|..:| ..|| ::.|.::|||.|.:|......:
Human  3595 ADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFI-KKLPFTQHPEIFGLHENVDISKDLQQT 3658

  Fly  4265 ERLFRIVFELQPRMTGGS-SGGETVSQEDIIKNIIEDILDKTPTPFNILELMG----RVEDRSPY 4324
            :.||..:...|    ||| ..|.:.|.:.|:..|.:|||:|.|:.|:|...:.    |.|:....
Human  3659 KTLFESLLLTQ----GGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNT 3719

  Fly  4325 IIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLG 4389
            ::|  ||.||.|||:..::.:|.:|:..:||.:.:.|.:|.|...|.:.:|||.|.|.:|||:..
Human  3720 VLV--QEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKP 3782

  Fly  4390 LQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVT 4454
            |.|:.:|.:.||..|:.|....: |...||:|||..|:.||..||..|||...|:|.:....:|.
Human  3783 LGSYITDFLARLNFLQDWYNSGK-PCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVI 3846

  Fly  4455 KKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIK-NV 4518
            .  .:...|:|.:|.||:||:::|||||.:.|.:|:.:.|.||..||:::||. ||..:.|| :.
Human  3847 P--SDTSDTSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKP-TQKSRIIKSDA 3908

  Fly  4519 YECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
            |.||:||...|..|         ||....||:.:....|...||.||.|
Human  3909 YVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVALLCQ 3957

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579 123/447 (28%)
P-loop_NTPase 1903..2132 CDD:304359 139/229 (61%)
P-loop_NTPase 2217..2352 CDD:304359 55/142 (39%)
P-loop_NTPase 2510..2783 CDD:304359 95/285 (33%)
P-loop_NTPase 2860..3127 CDD:304359 100/276 (36%)
MT 3140..3480 CDD:289543 117/354 (33%)
AAA_9 3509..3722 CDD:289547 91/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 249/710 (35%)
DNAH12NP_001352957.1 SMC_N <591..>752 CDD:330553 29/169 (17%)
DHC_N2 683..1110 CDD:312039 121/434 (28%)
MT 891..3605 CDD:330758 997/2791 (36%)
AAA_9 2896..3112 CDD:315453 91/216 (42%)
Dynein_heavy 3255..3955 CDD:308587 253/718 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46532
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.