DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH10

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_005253612.1 Gene:DNAH10 HGNCID:2941 Length:4589 Species:Homo sapiens

Alignment Length:4720 Identity:1452/4721 (31%)
Similarity:2391/4721 (51%) Gaps:533/4721 (11%)


  Fly    82 VAYFIR-------YLTPLHLTDENMLNSLLIGDLLPNPLANL-SILCDEVFFPLLNNTVNQVGWT 138
            |.:|:|       ..|.:....|.|..:|..|.:..|.|..| :|:| :||.|.|:...::...|
Human   160 VVFFLRNTKEAISEATDMKEAMEIMPETLEYGIINANVLHFLKNIIC-QVFLPALSFNQHRTSTT 223

  Fly   139 NVIANDMKTESQEMRNGIAQMKG---------LV--------------INRTIFPLPICMDEVMQ 180
            ..:.:...:.|.|..:.:..|.|         |:              |.||:..|.   .|:..
Human   224 VGVTSGEVSNSSEHESDLPPMPGEAVEYHSIQLIRDEFLMNVQKFASNIQRTMQQLE---GEIKL 285

  Fly   181 AAPAIAM-GDIS--VVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWES 242
            ..|.|:: |::|  ..:|.....||..|:.||:.:...|..:..:....|.  ||.|  ..||..
Human   286 EMPIISVEGEVSDLAADPETVDILEQCVINWLNQISTAVEAQLKKTPQGKG--PLAE--IEFWRE 346

  Fly   243 RLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDK 307
            |...|..|.||.....::.:..|:::..|:...:.:.:...:.:...||.|..:.||.::|....
Human   347 RNATLSALHEQTKLPIVRKVLDVIKESDSMLVANLQPVFTELFKFHTEASDNVRFLSTVERYFKN 411

  Fly   308 FETNDMDENRSDIRPLMLT-IGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGD 371
            ...........|..|.|:: :.:||..||:::....|..........:.:.|.|.|...::|:.:
Human   412 ITHGSGFHVVLDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKEN 476

  Fly   372 VDEAYKKLDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELK 436
            ...|..|.......|..:|..|.:.|     .||..:.....|.:.:..:|.|.|......::|.
Human   477 RASAQSKTLEARNTLRLWKKAYFDTR-----AKIEASGREDRWEFDRKRLFERTDYMATICQDLS 536

  Fly   437 DLFNTVRDFQKL----EKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQ 497
            |:...:.:|..:    .|.|.|..|      .::.:|...:.:.....|:.::|.  ..::|.|.
Human   537 DVLQILEEFYNIFGPELKAVTGDPK------RIDDVLCRVDGLVTPMENLTFDPF--SIKSSQFW 593

  Fly   498 RDRL-SFKAKTDVMERMV------SFQFEKGLEDTHDLLLA-GSLLLRPIIKKHVEPLMHVIVDD 554
            :..: .||.:..|:|:..      ||:..:..|...|:||. ..:..|..:.:.:....:.|:..
Human   594 KYVMDEFKIEVLVIEKEAKHFIDESFKTLRSAEAAFDMLLKFKHIRSREAVNRQMMMKFNDILAQ 658

  Fly   555 FEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAI----SFLKKLRHRIIGLHKEHELYE 615
            :.:||..:.|.|:.        .|...|.....|.|:|||    |...:::|.|:...:..|   
Human   659 YCKEIDIINKIFVQ--------NLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQE--- 712

  Fly   616 YPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEK----------DE 670
              :.|::||..|...:    .|:....|...|: ..|.|..:.:.:...|::|          :|
Human   713 --ILDSDRGQEVKQKY----LEVGRTMKEYEDR-KYEQWMEVTEQVLPALMKKSLLTKSSIATEE 770

  Fly   671 ANELR------VNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYND 729
            .:.|.      :||:..|...:.:.|.:..||..|.........:||:..:....:.|:.:.|  
Human   771 PSTLERGAVFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHY-- 833

  Fly   730 TFERAHPTEKRLIAAEMILIEEQMKPLLDF-------IKWNAFSQRFIVMIFKMVKYLHDRLVAA 787
                 |.....|..||.:|:::..:.||..       :.||:                    :..
Human   834 -----HMLIGTLNDAESVLLKDHSQELLRVFRSGYKRLNWNS--------------------LGI 873

  Fly   788 QENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLF 852
            .:.:...|::|   ||   |:.       |:|...:         ||.|....:.|:..:||   
Human   874 GDYITGCKQAI---GK---FES-------LVHQIHK---------NADDISSRLTLIEAINL--- 913

  Fly   853 FDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEE 917
            |..|.         .:.:||..|:                        ::..|..|.|::...:.
Human   914 FKYPA---------AKSEEELPGV------------------------KEFFEHIERERASDVDH 945

  Fly   918 IITPFHRYELLKG--LSQEE--------------RALFREYEIYVDEIIAENLVDSVITSSTYLR 966
            ::    |:.|..|  |::.|              .:.::.:|..:.|::.:.::.::.:.::.:.
Human   946 MV----RWYLAIGPLLTKVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLIL 1006

  Fly   967 MEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQ--- 1028
                    .|.|:|.....|..|.::...|.:...|..|        ..:.|.:.:.|...:   
Human  1007 --------GNVPLFHTETILTAPEIILHPNTNEIDKMCF--------HCVRNCVEITKHFVRWMN 1055

  Fly  1029 -----------DPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSL 1082
                       :..||..:|   ||:::....::.:|.|.|...:...|..:..:.:.:..:..|
Human  1056 GSCIECPPQKGEEEEVVIIN---FYNDISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPL 1117

  Fly  1083 WIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRT 1147
            |..||:..:   :||                        ..:.||...|.|:|..:.::..::..
Human  1118 WKLDKAIVM---EKF------------------------AAKKPPCVAYDEKLQFYSKIAYEVMR 1155

  Fly  1148 WETYEDFFVFLRLNMTGFKVAVLSQVGQW-ISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQ 1211
            ....:|... :||.:......|......| |||.|  |:|  :::.:||.:..:|...:.| .|:
Human  1156 HPLIKDEHC-IRLQLRHLANTVQENAKSWVISLGK--LLN--ESAKEELYNLHEEMEHLAK-NLR 1214

  Fly  1212 K--DDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKV 1274
            |  :..|.|..:|:.:.:|..|..:.:..:..::|....:..||....|.|...::::...|..:
Human  1215 KIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYNLFPPDAEKELVDKIESIWSNL 1279

  Fly  1275 KRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKF--LSKKFFF-------------VPC 1324
            ...:...:..:..|:....:|....|:       .||.:.  .:|:|:.             |..
Human  1280 FNDSVNVEHALGDIKRTFTELTRGEIM-------NYRVQIEEFAKRFYSEGPGSVGDDLDKGVEL 1337

  Fly  1325 LSCYELIDESDLELVALEERQRSLAESAVLFEL---QGPDPVKIELCRFDLKLVKIMWDFAITIQ 1386
            |..||      .||...|:.::.||.:..||:|   ..|:.:|::.   ::..::::::....::
Human  1338 LGVYE------RELARHEKSRQELANAEKLFDLPITMYPELLKVQK---EMSGLRMIYELYEGLK 1393

  Fly  1387 STINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQN 1451
            ....:|.:|.|..::::.:.:..:.|.|.||.|.:.:|......::||.:|....|:..:.:|:|
Human  1394 VAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKN 1458

  Fly  1452 PAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATA 1516
            .|:|||||.|||:.|.|.|.|.::.||:::..:.||::.:.:..||..::||:|:||.:::|...
Human  1459 EALRDRHWKELMEKTSVFFEMTETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDT 1523

  Fly  1517 WGTMEFGTDIHDRTSIKLLKAS----------EELIETLEDHQGQLQNMASSKYIAFFEHEVRLW 1571
            |..|:|       |.:|..|.:          :|:|::|:|:...||:::.|:::..|...|..|
Human  1524 WENMKF-------TVVKYCKGTQERGYILGSVDEIIQSLDDNTFNLQSISGSRFVGPFLQTVHKW 1581

  Fly  1572 QNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNV 1636
            :..||...::|..|..|||||.||||||||. ||||||||::::||.|||.||.::.:...| .|
Human  1582 EKTLSLIGEVIEIWMLVQRKWMYLESIFIGG-DIRSQLPEEAKKFDNIDKVFKRIMGETLKD-PV 1644

  Fly  1637 VRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVA 1701
            ::....:.::|.: |:.:.:.|..|:|:|||||::||.::|||:|:|..:||.||.: ::|..|.
Human  1645 IKRCCEAPNRLSD-LQNVSEGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILGS-SDPLCVQ 1707

  Fly  1702 RHLTKLYDSMGKLNL---ISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLR 1763
            .|:.|:||::..|..   .||.|..:.|::.| .|.:.|.:.....|:||.|:..:.::||.|.|
Human  1708 EHMIKMYDNIASLRFNDGDSGEKLVSAMISAE-GEVMEFRKILRAEGRVEDWMTAVLNEMRRTNR 1771

  Fly  1764 DQLKRSLTFY-DHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQ 1827
            ...|.::..| :.:.|..|:..:.....|..:|:.||.|..|.|.|.|:..:.|:|:|.:|...|
Human  1772 LITKEAIFRYCEDRSRVDWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQ 1836

  Fly  1828 LNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDC 1892
            ::.|:..:...|:..:|:|..|:..||||:||:|.:.|...:.....|.|:||||..||.:.|:.
Human  1837 IDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDEL 1901

  Fly  1893 FANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRA 1957
            ....|...|.|.|||:|...||||||||||.|:||||:|.:.:|||||||||||||||||||.:|
Human  1902 NIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKA 1966

  Fly  1958 LGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQ 2022
            ||::..|.||.|.|||:::|.|..||||.||||||||||||...||||::.|::.|::|:..:..
Human  1967 LGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLT 2031

  Fly  2023 TFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEA 2087
            ||.|.|:.|:|.:.:|:|||||||||||.||||::|||:||..::|||...|.||||.:|||.||
Human  2032 TFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEA 2096

  Fly  2088 RLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPK 2152
            :.||:|...||.|.:|.||||.|||:||||:|||||:||.|:|......||.||||||||.|:||
Human  2097 KTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMNLPK 2161

  Fly  2153 IVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFIL------KIVQLEEL 2211
            .|.:|||:|:|||.||||.||.||.|.|:|...::      ::..|:|:.:      |:||:.|.
Human  2162 FVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVE------QVLEENGYAVLPIQVDKVVQMFET 2220

  Fly  2212 FAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGL 2276
            ...||:..::|....|||.|..||.:.............||||||:..||:||::|:||:|.||:
Human  2221 MLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTTRDWTDGV 2285

  Fly  2277 FSILMRD-QANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIA 2340
            .|.:.|: .........|:|:.|||:|.:|:|::|:|||||::||||:.|||.|.....||||:.
Human  2286 LSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVG 2350

  Fly  2341 SLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIF----- 2400
            .|:.|:||||||.|::|::|::|.:.|:.:.|:....|..|...||.||:||||.|:|:.     
Human  2351 DLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIV 2415

  Fly  2401 ----RTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQD- 2460
                ..:|::|.|.:|:..:.....:||::|  :....|.  |..|.||:..:....|:||.:| 
Human  2416 DGRQAEKLKTIVPQTDLNMVTQLAKMLDALL--EGEIEDL--DLLECYFLEALYCSLGASLLEDG 2476

  Fly  2461 --------------QIID----WSNEFSKWFLNEYKAVKFPLSG---TIFSFYIDHETKKFFPWT 2504
                          ..:|    |:|...             |.|   |::.|:.|::..::.||:
Human  2477 RMKFDEYIKRLASLSTVDTEGVWANPGE-------------LPGQLPTLYDFHFDNKRNQWVPWS 2528

  Fly  2505 NLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSD 2569
            .|||::....:....:.||:|.:|||..:.::.:::...|::.:|.||:.||......|..|..:
Human  2529 KLVPEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNLSEE 2593

  Fly  2570 KYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTL 2634
            ...|..|.|:..|||..:||.||..:||:....|||...||::.|:||||||.||:|.|.||..|
Human  2594 TNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIAL 2658

  Fly  2635 IRQFMDYHHWYDRQK-MTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHI 2697
            ::..::..:.|||.| :..:.|.....:|.|..:.|... :|||....|..|.|..||:::|..|
Human  2659 LKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLI 2723

  Fly  2698 LNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGV 2762
            .:|||..|...    |.::::.:...:....:.|:..:|....||..||||.|||||::.:|.|:
Human  2724 YSSILKGHTST----FHESIVAVSGKLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGL 2784

  Fly  2763 LYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDD--VVYAQP 2825
            :.:|.|......||:|:|.:||.||:.|:|:..||....::.:..:|   :|...||  ||...|
Human  2785 VLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLV---VEHFKDDVEVVMRDP 2846

  Fly  2826 LIYCHFAKGLTDIK---YMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILE 2887
            :::..|...|.:.:   |..|..::..|:|..|..:.||:....|||||||||:.|:.|:.||:.
Human  2847 ILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNESNTKMNLVLFDDALEHLTRVHRIIR 2911

  Fly  2888 SSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCF 2952
            ..||:|||:||||||||||:|||:|.:|.:||:|.|::.||.:..:.::.:||:|.|::..|..|
Human  2912 MDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIF 2976

  Fly  2953 LMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKV 3017
            |.||:.||.|.||.|:|::|.||.:..||.::|.|:|::.:..|..:.|:...:|:.|:||:.|.
Human  2977 LFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKS 3041

  Fly  3018 RSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALP 3082
            .:.|.:||..||||.|||...|.||.:||.|.||||..||.|||.:|:..||....::|.|....
Human  3042 ANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIEN 3106

  Fly  3083 VSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIK 3147
            |...:..||::|:..|:.:|...:|.||.|||::|:.|..|||||.||.:.|:.:..||:.||.|
Human  3107 VVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDK 3171

  Fly  3148 LASCTKEVDALQDVLKVQEVELKIKNQEADNLI--IVVGT----ENEKVSKERAFASKEEKNVRQ 3206
            |...|.::|.|...|..|::.|..|:...:.|:  |.|.|    |.:|:::|:|...:|:..|..
Human  3172 LKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIA 3236

  Fly  3207 IEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK 3271
            :|     ||: .|....:..|.|.||:..|..|:|:::||::||..||..|.:||..:|::   |
Human  3237 ME-----KAE-AETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIM---K 3292

  Fly  3272 GKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAG 3336
            |.  |:.:||..:..|.: ..||.:|:..|...|....:|.::..:.....:.|::.|.|.|..|
Human  3293 GY--KELNWKTAKGVMSD-PNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLG 3354

  Fly  3337 LCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALA 3401
            :..:|..:..:.||:..::||...:...|:.....:.:|..:...|..::::|..|..:|:.|:.
Human  3355 MLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAIL 3419

  Fly  3402 KKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFT 3466
            :|||.|:||......:..|::||.||.:|.|||:..:..|.....:|.||.|:.:.|:||.|.||
Human  3420 EKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFT 3484

  Fly  3467 RAYRQELQEKLWMPAFKNSQPPIPSTDGVDPF---EMICDDAQIAEWNNQGLPSDRMSAENAAIL 3528
            ..:|.|:..::|.......:.|:.     .||   .::.||.:|:.|.:||||.|.:|.:|..:.
Human  3485 WEFRDEMVNRIWQNDILEREIPLS-----QPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILT 3544

  Fly  3529 VQSERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPV 3592
            .::.|:||.||||.|.:.|:|.| ....|.|...:..::|.|:|.::..|:..|..::.|.||||
Human  3545 TRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPV 3609

  Fly  3593 LNPLL--------GRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTV 3649
            ::.:|        |||.|      .:||:|:|::|.|||.|:||||||.|.|.:..:..:||:||
Human  3610 IDNVLEKNIKVSQGRQFI------ILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTV 3668

  Fly  3650 TRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVM 3714
            |..|||||||:.:|..||.:||..|..|.|:.:..|..||.|||.||..|:::..|:|::|.||.
Human  3669 TLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVH 3733

  Fly  3715 NLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFT 3779
            .||:||..|.|:..|:..|:.|.:.||..|:.|||||.|.:|::|:|:::..:|.:||:||.||.
Human  3734 TLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFL 3798

  Fly  3780 VVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPT 3844
            .||..::.|::....|..|:.|::|::||..:.:...||||:.||:|...:.|:|....|.|...
Human  3799 EVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQE 3863

  Fly  3845 ELDFLLRFPYMPNQTSN---FTWLTHVGWGGIRALNNQAV--FKGLEKDIEGSHKRWKKFVDSES 3904
            ||||.|:......::..   ..||:..||..|..|:....  |..|..|:|.:...|:::.|.:|
Human  3864 ELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDS 3928

  Fly  3905 PENEKFP---GEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESS 3966
              .|:||   |.....:..|:|.|:||.|.||:..|:..::...:|.||:....:.|...||:|:
Human  3929 --LEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQST 3991

  Fly  3967 PETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQ 4031
            |.:.|.|:||||.||..|:.||.:..||..:...|  :::|||||.||...:|.|...|.|::||
Human  3992 PHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKF--LAMGQGQEKVALQLLETAVARGQWLMLQ 4054

  Fly  4032 NIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMA 4096
            |.||:.:||..|||.:| .::..|..:||:|:.:|...     .|.|||:.::|:..|||.|:..
Human  4055 NCHLLVKWLKDLEKSLE-RITKPHPDFRLWLTTDPTKG-----FPIGILQKSLKVVTEPPNGLKL 4113

  Fly  4097 NIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYV 4161
            |:.......|.|.|:.| ....||.:::.|.:|||||.||||||..|||..|.||..|..:.:.:
Human  4114 NMRATYFKISHEMLDQC-PHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEI 4177

  Fly  4162 LYNYL-----EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG 4221
            |..||     :.:.|:||..|:||.||:||||...|.:|||:...|::|::...:.|        
Human  4178 LNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFD-------- 4234

  Fly  4222 FPAPGILKYTGYHNY----IDDNLP-----------------SESPSLYGLHSNAEIGFLTTVSE 4265
                   .:..:|.:    :|..:|                 :.:|.::|||.|||||:.|..:.
Human  4235 -------TFQPFHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAAR 4292

  Fly  4266 RLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRV-EDRSPYIIVAF 4329
            .::..:.||||: ||.||.|  :|::|.|..:.::|.:|.|..|::.::..|: ...||..:|..
Human  4293 DMWAHLLELQPQ-TGESSSG--ISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVVLL 4354

  Fly  4330 QECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWF 4394
            ||.||.|.|:..:.:||.||...|.||:.:|:.::|:...|::..:|..|.:||..::..|.:|.
Human  4355 QELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWM 4419

  Fly  4395 SDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTK-KWK 4458
            ...:.|..:...||.:.. ||.:||:|...|:|.|||::|.|.|||.|||||..|...||| :..
Human  4420 VYFLRRFSQYMLWVTESE-PSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDA 4483

  Fly  4459 EELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPV 4523
            :|:.....:|.:::||::|||.||::.|.:..:..|.|...:|:|.|..:...:..::|.:..||
Human  4484 DEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPV 4548

  Fly  4524 YKIRLR----GPTFVWTFNLKSRERASKWTLAGVCLLLQT 4559
            |...:|    |...|:..:|.:....|.|.|.||||.|.:
Human  4549 YTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNS 4588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 120/606 (20%)
DHC_N2 1368..1770 CDD:285579 134/415 (32%)
P-loop_NTPase 1903..2132 CDD:304359 142/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 58/136 (43%)
P-loop_NTPase 2510..2783 CDD:304359 89/275 (32%)
P-loop_NTPase 2860..3127 CDD:304359 120/267 (45%)
MT 3140..3480 CDD:289543 102/346 (29%)
AAA_9 3509..3722 CDD:289547 91/222 (41%)
Dynein_heavy 3864..4549 CDD:281078 239/722 (33%)
DNAH10XP_005253612.1 DHC_N1 304..876 CDD:285571 121/634 (19%)
DHC_N2 1375..1778 CDD:285579 134/418 (32%)
P-loop_NTPase 1912..2140 CDD:304359 142/228 (62%)
P-loop_NTPase 2228..2363 CDD:304359 59/135 (44%)
P-loop_NTPase 2538..2805 CDD:304359 89/271 (33%)
P-loop_NTPase 2884..3151 CDD:304359 120/267 (45%)
MT 3163..3496 CDD:289543 101/345 (29%)
AAA_9 3525..3741 CDD:289547 91/222 (41%)
Dynein_heavy 3882..4578 CDD:281078 239/726 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.