DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH9

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_011522005.1 Gene:DNAH9 HGNCID:2953 Length:4501 Species:Homo sapiens

Alignment Length:4634 Identity:2311/4635 (50%)
Similarity:3121/4635 (67%) Gaps:219/4635 (5%)


  Fly     1 MADEKEKKEP-VDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKK--RIIFTI 62
            :|.|....|| .|.|......|:..::|.....|.:...:.|...::..||.....:  |.:..:
Human    10 LAAENADGEPGADRRLRLLGTYVAMSLRPAAGAWERCAGSAEAEQLLQAFLGRDAAEGPRPLLVV 74

  Fly    63 NSGGQLYPSYSFPVRPRYKVA-----------YFIRYLTPLHLTDENMLNSLLIGDLLPNPLANL 116
            ..|.:     ...:||..:|.           :|:| ..|.....::...:::.|||...||.:|
Human    75 RPGPR-----GLAIRPGLEVGPESGLAGAKALFFLR-TGPEPPGPDSFRGAVVCGDLPAAPLEHL 133

  Fly   117 SILCDEVFFPLLNNTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQA 181
            :.|..||..|:|.|..|::.|.::|..|::..:..::..::.:...|..:|:.||| ...|.|:.
Human   134 AALFSEVVLPVLANEKNRLNWPHMICEDVRRHAHSLQCDLSVILEQVKGKTLLPLP-AGSEKMEF 197

  Fly   182 APAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLEN 246
            |.:.:...:..::..:.:::|..|:||...|:.::..::.:.:...|| |.|:....||:||.|:
Human   198 ADSKSETVLDSIDKSVIYAIESAVIKWSYQVQVVLKRESSQPLLQGEN-PTPKVELEFWKSRYED 261

  Fly   247 LENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETN 311
            |:.:..||....::.:..:|:|:||.:..:::.:...|:.:||||:||...|.||:|.::..|..
Human   262 LKYIYNQLRTITVRGMAKLLDKLQSSYFPAFKAMYRDVVAALAEAQDIHVHLIPLQRHLEALENA 326

  Fly   312 DMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAY 376
            :..|.:..:|||:..:.|:|...:.:.:...:|:......|.||...:..:.|:.:.:.:|:|:.
Human   327 EFPEVKPQLRPLLHVVCLIWATCKSYRSPGRLTVLLQEICNLLIQQASNYLSPEDLLRSEVEESQ 391

  Fly   377 KKLDINMQHLEYYKLIYNECRNSLKKFKIGTTFNS----QDWTWHQDEIFGRLDKFLVRLEELKD 437
            :||.:....|.::|..:.:.|.:|.     |.|..    ::|.:....:|.|||.||.:|..::.
Human   392 RKLQVVSDTLSFFKQEFQDRRENLH-----TYFKENQEVKEWDFQSSLVFVRLDGFLGQLHVVEG 451

  Fly   438 LFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYR----EWTNIQYNPIDPDAENSLFQR 498
            |..|..||.||.|:...|::|..::..::::.||:..:||    ..::..|      .:::.|:.
Human   452 LLKTALDFHKLGKVEFSGVRGNALSQQVQQMHEEFQEMYRLLSGSSSDCLY------LQSTDFEN 510

  Fly   499 DRLSFKAKTDVMERMV------SFQFEKGLEDTHDLL-LAGSLLLRPIIKKHVEPLMHVIVDDFE 556
            |...|..|.:.::|.:      :|....|||....|| :||:||.||::.:.......|::..|.
Human   511 DVSEFNQKVEDLDRRLGTIFIQAFDDAPGLEHAFKLLDIAGNLLERPLVARDTSDKYLVLIQMFN 575

  Fly   557 EEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDN 621
            :::..|:..:.........||.:  |.....|.|:|.:.:.::||.||.|.........:|..::
Human   576 KDLDAVRMIYSQHVQEEAELGFS--PVHKNMPTVAGGLRWAQELRQRIQGPFSNFGRITHPCMES 638

  Fly   622 ERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKD-EANELRVNFTERLIFA 685
            ..|..:...:..|:..::.:...|.:.|.....:..|.:::..|:::| |..|:.:||..:||..
Human   639 AEGKRMQQKYEDMLSLLEKYETRLYEDWCRTVSEKSQYNLSQPLLKRDPETKEITINFNPQLISV 703

  Fly   686 LKDIKVVRLLGC-DVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILI 749
            ||::..:..... .:.......|...|...|....|..:|.|||...:.....|..|:..|:..|
Human   704 LKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLLEVEFPLVEEELQNI 768

  Fly   750 EEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHD---RLVAAQENLEAIKESIRSWGKVPLFQRKD 811
            :.:::...:.:.|.  ::.....:.::...:||   |:...::|:|.|:..:::| ..|:|:.||
Human   769 DLRLRAAEETLNWK--TEGICDYVTEITSSIHDLEQRIQKTKDNVEEIQNIMKTW-VTPIFKTKD 830

  Fly   812 LNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGI 876
                     ..||.:||:.                                              
Human   831 ---------GKRESLLSLD---------------------------------------------- 840

  Fly   877 WPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLK-------GLSQE 934
                                  |..|.:|::                 |.|:|       .|.||
Human   841 ----------------------DRHDRMEKY-----------------YNLIKESGLKIHALVQE 866

  Fly   935 ERALFRE------YEIYVDEIIAENLVDSVITSSTYLRMEVDNRY--ENN------TPIFEIFME 985
            ...||..      ::.||      |.:|:::.:..:|.:|...:|  ||.      |||||..:.
Human   867 NLGLFSADPTSNIWKTYV------NSIDNLLLNGFFLAIECSLKYLLENTECKAGLTPIFEAQLS 925

  Fly   986 LQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSE 1050
            |..|.:|::.:|::..|.||...:|.::..:..:.||:.|::..     |.:|: :..:|....:
Human   926 LAIPELVFYPSLESGVKGGFCDIVEGLITSIFRIPSLVPRLSPQ-----NGSPH-YQVDLDGIPD 984

  Fly  1051 LDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGS 1115
            |...|..:|.:::..:.....:...|.::|.|::.|:...|.:...:|..||.:|.:...:    
Human   985 LANMRRTLMERVQRMMGLCCGYQSTFSQYSYLYVEDRKEVLGQFLLYGHILTPEEIEDHVE---- 1045

  Fly  1116 SGVKLLGLEYPP-LSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISL 1179
            .|:.    |.|| ||.:|.|:|.:..|.:::...|..:.|..::::::..||.::|:.:.:|..|
Human  1046 DGIP----ENPPLLSQFKVQIDSYETLYEEVCRLEPIKVFDGWMKIDIRPFKASLLNIIKRWSLL 1106

  Fly  1180 FKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKE 1244
            ||..|::.|.:||..|..|:.::...|..:::|.||:|||:|:..|..:.|:|...|.||:|||:
Human  1107 FKQHLVDHVTHSLANLDAFIKKSESGLLKKVEKGDFQGLVEIMGHLMAVKERQSNTDEMFEPLKQ 1171

  Fly  1245 IIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANT 1309
            .|:||:.|..|..:|...|:.|||:.|..:|::|.|.||.:||:|:.:|.|:.:|....|.....
Human  1172 TIELLKTYEQELPETVFKQLEELPEKWNNIKKVAITVKQQVAPLQANEVTLLRQRCTAFDAEQQQ 1236

  Fly  1310 YRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKL 1374
            :.::|..:..|....:..::::|...:|:..:|....|::|||.|||:..||..::..||.::..
Human  1237 FWEQFHKEAPFRFDSIHPHQMLDARHIEIQQMESTMASISESASLFEVNVPDYKQLRQCRKEVCQ 1301

  Fly  1375 VKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNL 1439
            :|.:||....:.|:|:.|:.|||:.|::|.|:.|||:|.|.:|.|||.:|.|:.|..:|:::.|.
Human  1302 LKELWDTIGMVTSSIHAWETTPWRNINVEAMELECKQFARHIRNLDKEVRAWDAFTGLESTVWNT 1366

  Fly  1440 MTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEM 1504
            ::|||||.||||||||:|||.:|||.|.|.|:||..|||..|:.|.||.||:||:.||||:.|||
Human  1367 LSSLRAVAELQNPAIRERHWRQLMQATGVSFTMDQDTTLAHLLQLQLHHYEDEVRGIVDKAAKEM 1431

  Fly  1505 AMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVR 1569
            .|||.|:::.|.|..|||..:.|.||::.||.:.|:|||.|||:|.||||:..|||:|||..||.
Human  1432 GMEKTLKELQTTWAGMEFQYEPHPRTNVPLLCSDEDLIEVLEDNQVQLQNLVMSKYVAFFLEEVS 1496

  Fly  1570 LWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADR 1634
            .||.:||..|.:|..||||||.|.:|||||.||||||:|||:||:||:.||.:||.|........
Human  1497 GWQKKLSTVDAVISIWFEVQRTWTHLESIFTGSEDIRAQLPQDSKRFEGIDIDFKELAYDAQKIP 1561

  Fly  1635 NVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPAL 1699
            |||::||:.|  |||.||.:...|.||||||.:||:||||::|||||:||:|||||||||..|..
Human  1562 NVVQTTNKPG--LYEKLEDIQGRLCLCEKALAEYLDTKRLAFPRFYFLSSSDLLDILSNGTAPQQ 1624

  Fly  1700 VARHLTKLYDSMGKLNL---ISG--SKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMR 1759
            |.|||:||:|:|.|:..   .||  :|.:.||.:|| ||||.|.|.|||||:||:|||.:...|:
Human  1625 VQRHLSKLFDNMAKMRFQLDASGEPTKTSLGMYSKE-EEYVAFSEPCDCSGQVEIWLNHVLGHMK 1688

  Fly  1760 DTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQ 1824
            .|:|.::...:|.|:.|||..|:|:.|||.||..|||.||||...|||::::.||:|:|||.|||
Human  1689 ATVRHEMTEGVTAYEEKPREQWLFDHPAQVALTCTQIWWTTEVGMAFARLEEGYESAMKDYYKKQ 1753

  Fly  1825 ITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKI 1889
            :.||..||.:|:|.|:..:|||||||||||||:||||..:||:||:...||.|.||||||||.::
Human  1754 VAQLKTLITMLIGQLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQAFLWLSQLRHRWDDEV 1818

  Fly  1890 DDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDL 1954
            ..||||||||||.|.|||||||||||||||||||||||||||||.|.||||||||||||||||||
Human  1819 KHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDL 1883

  Fly  1955 GRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKS 2019
            |||||::||||||||||||||.|:|:|||||||||||||||||||||||||||||||.|||||:.
Human  1884 GRALGILVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRD 1948

  Fly  2020 KKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGF 2084
            |||.||||||.|:|..:||:|||||||||||.|||||||:|:||||||||||.||.|||||||||
Human  1949 KKQWFSFLGEEISLNPSVGIFITMNPGYAGRTELPENLKSLFRPCAMVVPDFELICEIMLVAEGF 2013

  Fly  2085 QEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFN 2149
            .||:.|||||||||.|||||||||||||||||||||||||||:|:|.|..|||||||||:|||||
Human  2014 IEAQSLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSLRDFN 2078

  Fly  2150 IPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAV 2214
            ||||||||:|:||||||||||||||||:|:|.|||:::::.:|||||.||.|:||:||||||.||
Human  2079 IPKIVTDDMPIFMGLIGDLFPALDVPRRRDPNFEALVRKAIVDLKLQAEDNFVLKVVQLEELLAV 2143

  Fly  2215 RHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSI 2279
            |||||::|.||||||:|.::|:||||..||:|.:.|||||||||||||||:||:|.||||||||.
Human  2144 RHSVFVVGGAGTGKSQVLRSLHKTYQIMKRRPVWTDLNPKAVTNDELFGIINPATGEWKDGLFSS 2208

  Fly  2280 LMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRT 2344
            :||:.||:...|||||:|||||||||||||||||||||||||||||||.|...|:|||||:.|||
Human  2209 IMRELANITHDGPKWILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMKLLFEISHLRT 2273

  Fly  2345 ATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITP 2409
            ||||||||||||||||.||||.|.:.||:..|...:|.:.|.:|||||:|..||..|||.:.|.|
Human  2274 ATPATVSRAGILYINPADLGWNPPVSSWIEKREIQTERANLTILFDKYLPTCLDTLRTRFKKIIP 2338

  Fly  2410 ISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFL 2474
            |.:.:.:||.|:||:.:||.:::|.||||:.||.||||..:|.||.::.|||::|:..|||||:|
Human  2339 IPEQSMVQMVCHLLECLLTTEDIPADCPKEIYEHYFVFAAIWAFGGAMVQDQLVDYRAEFSKWWL 2403

  Fly  2475 NEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLI 2539
            .|:|.||||..||||.:|||.|||||.||:.||||||.|.::|||:.||:|:||.|:.:||:.|:
Human  2404 TEFKTVKFPSQGTIFDYYIDPETKKFEPWSKLVPQFEFDPEMPLQACLVHTSETIRVCYFMERLM 2468

  Fly  2540 EADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYG 2604
            ....|:||:|.:|:||::|:.|||::|..:.|.|.|||||:||||.|||.:||||||||||||||
Human  2469 ARQRPVMLVGTAGTGKSVLVGAKLASLDPEAYLVKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYG 2533

  Fly  2605 PIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAG 2669
            |.|||::|||:|||||||||.|.||||||:|||.:||.|||||.|::|::|.....|:||||:||
Human  2534 PPGNKKLIYFIDDMNMPEVDAYGTVQPHTIIRQHLDYGHWYDRSKLSLKEITNVQYVSCMNPTAG 2598

  Fly  2670 SFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLK 2734
            ||||:|||||||..|.::.|..|||..|.:.||:||:  .:..|..::.|....::..|:..|.|
Human  2599 SFTINPRLQRHFSVFVLSFPGADALSSIYSIILTQHL--KLGNFPASLQKSIPPLIDLALAFHQK 2661

  Fly  2735 VVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDIN 2799
            :.::||||.|||||.|||||.||||.|:|:|:.|...::..:|||::||..|||.||:|:..|.:
Human  2662 IATTFLPTGIKFHYIFNLRDFANIFQGILFSSVECVKSTWDLIRLYLHESNRVYRDKMVEEKDFD 2726

  Fly  2800 SFKKIVSDIVRKGIEGVNDDVVYAQ-PLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDY 2863
            .|.||.:::::|..:.:.|.|...| |.:|||||.|:.:.||||:..|:.|...|.||.:.:|:.
Human  2727 LFDKIQTEVLKKTFDDIEDPVEQTQSPNLYCHFANGIGEPKYMPVQSWELLTQTLVEALENHNEV 2791

  Fly  2864 IGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYS 2928
            ...|:||||:|||.|||.|:|||||.||.|||:||||||||||||||:||||:|||||.|.|.|.
Human  2792 NTVMDLVLFEDAMRHVCHINRILESPRGNALLVGVGGSGKQSLTRLAAFISSMDVFQITLRKGYQ 2856

  Fly  2929 VSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAV 2993
            :.|.|.::|:|.:|||||.....|||||::||.|:||||:|||||||:|.:|:.|||||||::.|
Human  2857 IQDFKMDLASLCLKAGVKNLNTVFLMTDAQVADERFLVLINDLLASGEIPDLYSDDEVENIISNV 2921

  Fly  2994 RNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQ 3058
            |||||..|:|||||||||:||:::|..|||.|||||||..||||||||||:||||.|.|||||||
Human  2922 RNEVKSQGLVDNRENCWKFFIDRIRRQLKVTLCFSPVGNKLRVRSRKFPAIVNCTAIHWFHEWPQ 2986

  Fly  3059 QALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALY 3123
            |||||||||||.....:...:...:|.||||||.:||..|:.||:|.:||||||||||||.|.||
Human  2987 QALESVSLRFLQNTEGIEPTVKQSISKFMAFVHTSVNQTSQSYLSNEQRYNYTTPKSFLEFIRLY 3051

  Fly  3124 SKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENE 3188
            ..|||...|....:..||||||:||.|.:.:||.|:..|..||||||.||::||.||.|||.|.:
Human  3052 QSLLHRHRKELKCKTERLENGLLKLHSTSAQVDDLKAKLAAQEVELKQKNEDADKLIQVVGVETD 3116

  Fly  3189 KVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSP 3253
            |||:|:|.|.:||:.|..|..:|..|.|.||||..||:|||.|||.|||||||.|||||||||||
Human  3117 KVSREKAMADEEEQKVAVIMLEVKQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSP 3181

  Fly  3254 PDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYIL 3318
            |.||.:|..||:||.:.:|::||||||||.:..|..||.|||:|||::|::||.:.:||::||:.
Human  3182 PLAVSNVSAAVMVLMAPRGRVPKDRSWKAAKVTMAKVDGFLDSLINFNKENIHENCLKAIRPYLQ 3246

  Fly  3319 DAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLT 3383
            |.||:||.:..||.||||||||||||.|||:|:..||||.:||.::..::..|::||.|:..::.
Human  3247 DPEFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATADLTAAQEKLAAIKAKIA 3311

  Fly  3384 ELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQL 3448
            .|.|.|..|...:::|.|.|.|||.||..||.||.:||||:||||:|.:||.::|:......:.|
Human  3312 HLNENLAKLTARFEKATADKLKCQQEAEVTAVTISLANRLVGGLASENVRWADAVQNFKQQERTL 3376

  Fly  3449 PGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQ 3513
            .||||:|:.||||:|.||:.|||.|.::.|.|.....:.|||.|..:||..|:.|||.:|.|.|:
Human  3377 CGDILLITAFISYLGFFTKKYRQSLLDRTWRPYLSQLKTPIPVTPALDPLRMLMDDADVAAWQNE 3441

  Fly  3514 GLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGS 3578
            |||:||||.|||.||:..||:|||:|||||||||:|.|||..|.|.::.|:.||..:|:|:..|:
Human  3442 GLPADRMSVENATILINCERWPLMVDPQLQGIKWIKNKYGEDLRVTQIGQKGYLQIIEQALEAGA 3506

  Fly  3579 VLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTT 3643
            |:||||:.|:|||||.|||||::||||..:||||:|.::|.:||||||||||||||:||:|||.|
Human  3507 VVLIENLEESIDPVLGPLLGREVIKKGRFIKIGDKECEYNPKFRLILHTKLANPHYQPELQAQAT 3571

  Fly  3644 LINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLE 3708
            |||||||||||||||||.||.:||||||.:::.||:|||.||||||.|||.||:|||||..|.|.
Human  3572 LINFTVTRDGLEDQLLAAVVSMERPDLEQLKSDLTKQQNGFKITLKTLEDSLLSRLSSASGNFLG 3636

  Fly  3709 DVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQF 3773
            :..||.|||.||:||.|:|.||.|||:|.|:|:.|||.|||||.|||::|||:|||.||:|:|||
Human  3637 ETVLVENLEITKQTAAEVEKKVQEAKVTEVKINEAREHYRPAAARASLLYFIMNDLSKIHPMYQF 3701

  Fly  3774 SLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNL 3838
            |||||::||..|:.:|...|.|::||.||||||||..:.||.|||||.|||.:|.||..|||:..
Human  3702 SLKAFSIVFQKAVERAAPDESLRERVANLIDSITFSVYQYTIRGLFECDKLTYLAQLTFQILLMN 3766

  Fly  3839 GEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSE 3903
            .||...|||||||.|......|...:|:|..||.::.|::...|..|::|||||.|.|||||:||
Human  3767 REVNAVELDFLLRSPVQTGTASPVEFLSHQAWGAVKVLSSMEEFSNLDRDIEGSAKSWKKFVESE 3831

  Fly  3904 SPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPE 3968
            .||.||.|.|||.|:|:||||::|.:|||||:||:|.|:||||||||:..|:::|:.:||||.|.
Human  3832 CPEKEKLPQEWKNKTALQRLCMLRAMRPDRMTYALRDFVEEKLGSKYVVGRALDFATSFEESGPA 3896

  Fly  3969 THIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNI 4033
            |.:||:||||||||||||..|:.||::|:::|||:||||||||:|||.|:::|::.|||||||||
Human  3897 TPMFFILSPGVDPLKDVESQGRKLGYTFNNQNFHNVSLGQGQEVVAEAALDLAAKKGHWVILQNI 3961

  Fly  4034 HLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANI 4098
            ||||:||.:||||:|....|.|..:|:|:|||||..|..||:||||||::|||||||||||.||:
Human  3962 HLVAKWLSTLEKKLEEHSENSHPEFRVFMSAEPAPSPEGHIIPQGILENSIKITNEPPTGMHANL 4026

  Fly  4099 HKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLY 4163
            |||||||:.:||||||:|||||:|||:||||||||||||||||||||||||||.|||||||.|||
Human  4027 HKALDNFTQDTLEMCSRETEFKSILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLY 4091

  Fly  4164 NYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGIL 4228
            |:||||.:||::||||||||||||||||||||||||||||.||::||:::|||....|||.||.:
Human  4092 NFLEANAKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLGEFIRPEMLEGELSLAPGFPLPGNM 4156

  Fly  4229 KYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDI 4293
            .|.|||.|||..||.|||.|||||.||||||||..||:|||.|.|||||.:....|.....:|.:
Human  4157 DYNGYHQYIDAELPPESPYLYGLHPNAEIGFLTQTSEKLFRTVLELQPRDSQARDGAGATREEKL 4221

  Fly  4294 --------------IKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKR 4344
                          :|.::|:||::....|||.|||.:||:|:|||:||||||.|||.|..|::|
Human  4222 FSWRWHCVLTIQGKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVAFQECGRMNILTREIQR 4286

  Fly  4345 SLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVA 4409
            ||.||:||||||||::|.||:|...||.|.|||.|.:.||||..||.:||.||:.|::|||.|..
Human  4287 SLRELELGLKGELTMTSHMENLQNALYFDMVPESWARRAYPSTAGLAAWFPDLLNRIKELEAWTG 4351

  Fly  4410 DFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGL 4474
            ||.|||::||.|||||||.||||||.||||||||||:|.|.||:|||.:||..:.|||||||:||
Human  4352 DFTMPSTVWLTGFFNPQSFLTAIMQSTARKNEWPLDQMALQCDMTKKNREEFRSPPREGAYIHGL 4416

  Fly  4475 FMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNL 4539
            |||||.||.:.|.|.:|.||:|.|.|||::|||:..||||.::||.|||||...||||:||||||
Human  4417 FMEGACWDTQAGIITEAKLKDLTPPMPVMFIKAIPADKQDCRSVYSCPVYKTSQRGPTYVWTFNL 4481

  Fly  4540 KSRERASKWTLAGVCLLLQ 4558
            |::|..|||.||||.||||
Human  4482 KTKENPSKWVLAGVALLLQ 4500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 136/583 (23%)
DHC_N2 1368..1770 CDD:285579 216/407 (53%)
P-loop_NTPase 1903..2132 CDD:304359 199/229 (87%)
P-loop_NTPase 2217..2352 CDD:304359 102/135 (76%)
P-loop_NTPase 2510..2783 CDD:304359 150/273 (55%)
P-loop_NTPase 2860..3127 CDD:304359 177/267 (66%)
MT 3140..3480 CDD:289543 184/340 (54%)
AAA_9 3509..3722 CDD:289547 141/213 (66%)
Dynein_heavy 3864..4549 CDD:281078 447/699 (64%)
DNAH9XP_011522005.1 DHC_N1 212..789 CDD:285571 136/593 (23%)
DHC_N2 1295..1699 CDD:285579 216/407 (53%)
P-loop_NTPase 1832..2062 CDD:304359 200/230 (87%)
P-loop_NTPase 2146..2281 CDD:304359 102/135 (76%)
AAA_7 2439..2710 CDD:289541 150/273 (55%)
AAA_8 2788..3055 CDD:289546 177/267 (66%)
MT 3067..3410 CDD:289543 185/343 (54%)
AAA_9 3438..3650 CDD:289547 141/212 (67%)
Dynein_heavy 3790..4491 CDD:281078 447/701 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355002752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.