DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH8

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001193856.1 Gene:DNAH8 HGNCID:2952 Length:4707 Species:Homo sapiens

Alignment Length:4731 Identity:1363/4732 (29%)
Similarity:2316/4732 (49%) Gaps:512/4732 (11%)


  Fly    74 FPVRPRYKVAYFIRYLTPLHL-----TDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVN 133
            |.||.|..||..::.:....|     ..:.:||.  |.|:|.|           :|.|.:..|.|
Human   237 FFVRCRNDVAINVKTIQEEALFTVLDASKGLLNG--IRDMLAN-----------IFLPAVLATNN 288

  Fly   134 QVGWTNVIANDMKTESQE-------------MRNGIAQMKGLVINRTI----FPLPICMDEVMQA 181
               | ..:....:.||::             :......::|.|..:||    |......:||..|
Human   289 ---W-GALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAA 349

  Fly   182 APAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLEN 246
            |.          |....|.||.:::.|...:|.::......:..:.::.||.|  ...|:.....
Human   350 AS----------NSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTE--LEHWKRMSAK 402

  Fly   247 LENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETN 311
            ...:.||:.....|.:..||....|....::|.:...:.::..|::|..:.|..|::.......:
Human   403 FNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNH 467

  Fly   312 DMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEP---DSIFQGDVD 373
            |:......|:.|:..|.::.|.|||::|...||..|....|.::......:..   :.::..:..
Human   468 DLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETP 532

  Fly   374 EAYKKLDINMQHLEYYKLIYNECRNSL------KKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRL 432
            ...||:...:...:.|:..:::.|..:      |.|::...:           |||:.:.|..||
Human   533 VVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMY-----------IFGKFEAFCKRL 586

  Fly   433 EELKDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQ 497
            |::.::...|:.:..|....:.|:....|.|         .:||:.....||:.:||  ..:.|.
Human   587 EKITEMITVVQTYSTLSNSTIEGIDIMAIKF---------RNIYQGVKKKQYDILDP--RRTEFD 640

  Fly   498 RDRLSFKAKTDVME----RMVSFQFEKGLEDTHDLLLAGSLLLR------PIIKKHVEPLMHVIV 552
            .|.|.|..|.:.:|    ..::..|.|.|.....|    .||.|      |.:...:...:..|:
Human   641 TDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQAL----QLLQRFQKLNIPCLGLEINHTIERIL 701

  Fly   553 DDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYP 617
            ..:..|:...||.:.:.|        ::.|.....|.::|.|.::::|..||      .|...| 
Human   702 QYYVAELDATKKLYHSQK--------DDPPLARNMPPIAGKILWVRQLYRRI------SEPINY- 751

  Fly   618 LFDNERGGYVSDIFN-----IMVQEIDDFTKMLLD-------KWTVECWQGIQQDITLTL-IEKD 669
            .|.|      |||.:     .::::.:..:.:|::       .|..|..| :...:..|| :...
Human   752 FFKN------SDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQ-LHYALQATLFVRHP 809

  Fly   670 EANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERA 734
            |..:|.|||..:::..:::.|.:..:..||.....:....|.:|...::.|..:.::|::..:..
Human   810 ETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEV 874

  Fly   735 HPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENL------EA 793
            ......|:..:|..:|..::..|..:.|::.:........::|..:.::|:....:|      ..
Human   875 PSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTV 939

  Fly   794 IKE-------SIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQR-LIDLLMYVNLK 850
            :||       |:...|...:.....||..   :|.....||:.::.:..:..| ||.:...:   
Human   940 LKEIAKTVLISLPESGATKVEDMLTLNET---YTKEWADILNHKSKHVEEAVRELISIFEQI--- 998

  Fly   851 LFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESE 915
              :::  :|:   |:.|::.|:...:   :.............:..:::|.|..::.:|.:.|.:
Human   999 --YEV--KYT---GKVGKQSEQRKHV---VFGSETGEGENNDYEANIVNEFDTHDKEDEFKKECK 1053

  Fly   916 EEIITPFHRYELLKGLSQEERALF--REYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTP 978
            |  :..|..::||..|.:..|...  .:..|:|..:......:.:|   ::::.||         
Human  1054 E--VFAFFSHQLLDSLQKATRLSLDTMKRRIFVASLYGRKQSEDII---SFIKSEV--------- 1104

  Fly   979 IFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSL------------------LKR 1025
                  .|..||||...:||            .|...:|.|:.|                  :|.
Human  1105 ------HLAIPNVVMIPSLD------------DIQQAINRMIQLTLEVSRGVAHWGQQQIRPIKS 1151

  Fly  1026 VAQDP--TEVTNMNP--------------------YSFYDELQDKSELDKQRVEIMNKIKLALQA 1068
            |...|  |:||:.|.                    .:||..:.:..::.|..:.:.:.:....:|
Human  1152 VIPSPTTTDVTHQNTGKLLKKEERSFEEAIPARKLKNFYPGVAEHKDISKLVLLLSSSVNSLRKA 1216

  Fly  1069 VRVHGKGFMEFSSLWIWDKSTYLSEVKKF-GRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYK 1132
            .....:.|.::.:||..|:..   :||:| ..|.:|.|..:|.            |.|   :.::
Human  1217 AHEALQDFQKYKTLWTEDRDV---KVKEFLANNPSLTEIRSEI------------LHY---ATFE 1263

  Fly  1133 EQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQD 1197
            :::|   ||:..|....        |.|:....|:|:..:...|..|....|....|..:..:..
Human  1264 QEID---ELKPIIVVGA--------LELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIA 1317

  Fly  1198 FVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELA 1262
            |::|  .:.|:.....|.:.:...:..|:.|.:.:...|....|::|...:|.::..|....|..
Human  1318 FINE--YLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESE 1380

  Fly  1263 QINELPDAWMKVKRLAATTKQLIAPIQ-SYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLS 1326
            .::.|..::.|::..|.:.::.:..:| .::.:|:|...:..:::.|......|...  .||.:.
Human  1381 AVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGP--MVPNIP 1443

  Fly  1327 CYELIDESDLELVALEERQR---SLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQST 1388
            ..|..:...:...:.::..|   :.:....||.|...|...:...|.:|.|::.::....|:.|:
Human  1444 PQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSS 1508

  Fly  1389 INDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPA 1453
            |:.:.:..|..:|||.::.|..:|....|.|.|.::.|:.|:.::..:.:...|...:..:.|.|
Human  1509 ISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKA 1573

  Fly  1454 IRDRHWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAW 1517
            ::.|||..:.:.|...|.:: ||..|:::::..|.::::::::|...::||..:|.:|..:...|
Human  1574 MKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENW 1638

  Fly  1518 GTMEFGTDIHDRTSIKLLKASE--ELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQ 1580
            ................|||.:|  |:|..:||....|.::.|::|.|.|:..::.|..:||.:..
Human  1639 TNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSD 1703

  Fly  1581 IIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRST--NRS 1643
            ||..|..||..|.|||::|:|. ||..|||::::||..|||.:..::.:.:.:.||:...  :.:
Human  1704 IIEEWLVVQNLWVYLEAVFVGG-DIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDET 1767

  Fly  1644 GSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLY 1708
            ..:|..||.   :.|.:|:|:|..|||.|||.:|||:|||...||:||...::...:..||..:.
Human  1768 MGQLLPHLH---EQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVS 1829

  Fly  1709 DSMGKLNL-ISGSKNAAGMVAKELEEYVPFLEN-CDCSGKVEVWLNRITDKMRDTLRDQLKRS-- 1769
            |::.::.. .........::::|.|:.|  |:| ....|.||:||..:......:|.:.::.:  
Human  1830 DNINEVTFHAKDYDRIMAVISREGEKIV--LDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFY 1892

  Fly  1770 ---------LTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQI 1825
                     |.|..|         :|||..|:|.|::||.::.:|.       .||..|....|:
Human  1893 QISDSGFQLLPFLSH---------FPAQVGLLGIQMLWTHDSEEAL-------RNAKDDRKIMQV 1941

  Fly  1826 TQ------LNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHR 1884
            |.      ||.||.....||:..:|.|..|:.||.||.||:...::...::..|.|:|..|.|..
Human  1942 TNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFY 2006

  Fly  1885 WDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTE 1949
            :...:|....:|.|..|.|..|:||.|.|||||||||||||||.|:|.:.|||||||||||||||
Human  2007 FKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTE 2071

  Fly  1950 TTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQ 2014
            ||||:||.||..|.|||||:|||::.:|.|.|||||:|:||||||||||.:.||||.|.|:..:.
Human  2072 TTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVL 2136

  Fly  2015 DAIKSKKQTFSFL-GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIM 2078
            .|.|.:|:.|.|. |:.:.|....|:|:|||||||||.|||||||..:|..||:|||..:|..:.
Human  2137 TARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVK 2201

  Fly  2079 LVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPED---QV 2140
            |.:.||.|..:||:||..||.||:|.|:||.|||:|||.|.|||...|:.:   |.||||   .:
Human  2202 LASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQK---RARPEDSELSI 2263

  Fly  2141 LMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFI--- 2202
            :||.|||.|:.|:|.:|.|:|:.||.||||.|.:......|.:     :|:..::|.| |.|   
Human  2264 VMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQ-----NAVAHQVQIE-GLINHP 2322

  Fly  2203 ---LKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYN-DLNPKAVTNDELFG 2263
               ||:|||.|...|||.:..:|.:|:||:.|...|.|. |.:..:||.. .:||||:|..::||
Human  2323 PWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKA-QTECGRPHREMRMNPKAITAPQMFG 2386

  Fly  2264 IVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIA 2328
            .::.:|.:|.||:||.|.|...........:::|||.:|.:|||:||:|:||||.||||:.:||.
Human  2387 RLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIP 2451

  Fly  2329 LTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYV 2393
            :....:||||:.::..|:||||||.|::||:...|.|.|.:|:||..|| :.|.::...|::|..
Human  2452 MAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRT-AQEAAVFLTLYEKVF 2515

  Fly  2394 PPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPN-DCPKDWYEIYFVFCIVWGFGSSL 2457
            .......:..|.....:.:...:..:..||:.::..:.... .|.:..::: |||.::|..|:.|
Human  2516 EDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLHKL-FVFGLMWSLGALL 2579

  Fly  2458 FQDQIIDWSNEFSKWFLNEYKAVKFPL-------SGTIFSFYI------DHETKKFFPW---TNL 2506
            ..:     |.|..:.||.:::: |..|       :.|::.||:      :|..||..|:   |:.
Human  2580 ELE-----SREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDS 2638

  Fly  2507 VPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKY 2571
            :|::        .|.||...:..|..|.:||:.:....::|.|..|:.||:::.|.|.....:..
Human  2639 IPEY--------SSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQ 2695

  Fly  2572 SVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIR 2636
            ...::.|:..|...|.||.:|..::|:.|..|||.|.::|..|:||:|||.::::.....:.::|
Human  2696 LSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVR 2760

  Fly  2637 QFMDYHHWYDRQK----MTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHI 2697
            |.|:....|...|    .|:.|:..  |.|.::|..|...|..||:|.|..|....||..::..|
Human  2761 QMMEMEGMYSLDKPGDFTTIVDVQL--IAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKI 2823

  Fly  2698 LNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGV 2762
            ...|...:.| |.:.|...:.::..|:|:....|........|||..||||.|||||::.|:.|:
Human  2824 FGIIGCGYFD-PCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGM 2887

  Fly  2763 LYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVS--------------------- 2806
            |...:|.|.:...::.|:.|||.||..|:.:...|...|...::                     
Human  2888 LTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYF 2952

  Fly  2807 -DIVRKGIEGVND---DVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYI--G 2865
             |.:|:..|...|   |.|:..|.||          :.||  .:|.|...|...|.::|:.|  .
Human  2953 VDFLREMPEPTGDEPEDSVFEVPKIY----------ELMP--SFDFLAEKLQFYQRQFNEIIRGT 3005

  Fly  2866 AMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVS 2930
            :::||.|.|||:|:.:||||:.:|.|.|||:||||||||||:||||||:...:|||.||:.|:|:
Human  3006 SLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVT 3070

  Fly  2931 DLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRN 2995
            :|..::..||..||.......|:.||||:..|.||..:|:||:||:|..||..||::.|...:.:
Human  3071 NLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLIS 3135

  Fly  2996 EVKQLGIVDNRE---------NCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTID 3051
            .:|       ||         |.::|||.:.|..|.|||||||||...|.||.|||.|::..|:|
Human  3136 VMK-------RELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMD 3193

  Fly  3052 WFHEWPQQALESVSLRFLSEITVL-PKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKS 3115
            ||..||::||.:|:..|||:..:: ..|:...|...|...|..|::..:.|....:|..:.||||
Human  3194 WFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKS 3258

  Fly  3116 FLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNL- 3179
            :|..|..|..:..||||...::..|:..||.||...::.|..|...|.|:|.||.:.:.:||.: 
Human  3259 YLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVL 3323

  Fly  3180 --IIVVGTENEKVSKE-RAFASKEEKNVRQIE-EDVTAKAKLCEEDFLKAQPALIAAQEALNTLN 3240
              :.|....:.|:..| :....|.:|.|.:|: |.|.|::||     ..|:|||..|:.||||:.
Human  3324 AEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKL-----EAAKPALEEAEAALNTIK 3383

  Fly  3241 KNNLTELKSFGSPPDAVVSVCGAVLVLFSSK-GKIPKDRSWKACRAFMGNVDK------FLDNLI 3298
            .|::..::....||..::.:...||:||..| ..:..|.....|:...|...|      ||.:|.
Human  3384 PNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQ 3448

  Fly  3299 NYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLE 3363
            .:.|..|:.:.::.||||....:::.|.........|||.||.:.:..||.:...|.|.:..|.:
Human  3449 QFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAK 3513

  Fly  3364 SEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLA 3428
            .|..:..|..:|......|.|.:.:|:.:|.::|.|:.:|....::|......:..|:.||.||:
Human  3514 QEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLS 3578

  Fly  3429 TEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTD 3493
            .|||||.:..|.....|.:|.||||:.:.|:||:|.|.:.:|..|.:..|....:..:  ||.|:
Human  3579 GEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARK--IPFTE 3641

  Fly  3494 GVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTK-YGTGLV 3557
            .::...|:.|...|.||..||||.|.:|.:|..|:.::.||||:||||.||..|:|:| ....|.
Human  3642 NLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQ 3706

  Fly  3558 VLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSR 3620
            |..|:.:.:...:|.::|.|..||||:|.|.:||.|:.:|.:..||.||.  :|:||:|.|....
Human  3707 VTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDT 3771

  Fly  3621 FRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFK 3685
            |:|.:.|||.||.:.||:.|:|::|:||||..|||:|||..|:..|:.:|||.|.:|.:.....|
Human  3772 FKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNK 3836

  Fly  3686 ITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPA 3750
            ..:|.|||:||.:||:...::::|.:|:..|..||:||.|:..|:..|..|.::|::|:|.:|||
Human  3837 RKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPA 3901

  Fly  3751 AERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTS 3815
            |.|.||:||::.::..:|.:||.||..|..:|:.:|.::..:...:.|:.|:|:.:|:..|.|:.
Human  3902 ATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSV 3966

  Fly  3816 RGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR---------FPYMPNQTSNFTWLTHVGWG 3871
            |||:|..|.:|:..:.::|.:..|.|:..|...|::         .|..|     :.|:..:.|.
Human  3967 RGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKP-----YRWILDMTWL 4026

  Fly  3872 GIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMS 3935
            .:..|:....|..:...|..:.|.||.:.|.::||.|..|..:... ....:|.::|...|||..
Human  4027 NLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTV 4091

  Fly  3936 YAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHEN 4000
            :..|.:|.:.|..||.:...:...:|:|||...|.:...||.|.||...::.|.|.|..     .
Human  4092 FQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKL-----E 4151

  Fly  4001 FHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHT--SYRLFLS 4063
            ..::|:|||||:.|...|:::.|.|.||:|||.||   .|..:|:.:|:.::...:  |:|::::
Human  4152 CRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHL---GLEFMEELLETLITTEASDDSFRVWIT 4213

  Fly  4064 AEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCY 4128
            .||...     .|..:|::::|.|||||.|:.|.:.:.....:.:.|:: |....:|.:|:::.:
Human  4214 TEPHDR-----FPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDI-SNLPMWKPMLYTVAF 4272

  Fly  4129 FHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL---EANTRVPWEDLRYLFGEIMYGGHI 4190
            .|:.|.|||||||.|||..|.||..|.:.||..:.|:|   :....|.|..:||:.||:.|||.:
Human  4273 LHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRV 4337

  Fly  4191 TDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPS-ESPSLYGLHSN 4254
            |||:|:||...:...:...::.:....:..|:..|.......|..|| .:||| ::|.::|||.|
Human  4338 TDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYI-QSLPSLDNPEVFGLHPN 4401

  Fly  4255 AEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPF------NILE 4313
            |:|.:.:..:..:...:..:||:.:||.. |||  :|.|:..:.||:|.|.|..:      :.|.
Human  4402 ADITYQSNTASAVLETITNIQPKESGGGV-GET--REAIVYRLSEDMLSKLPPDYIPHEVKSRLI 4463

  Fly  4314 LMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQ 4378
            .||.:...:   |...||.:||..:::.|:.||::|.|.::|.:.:|..:.|.:..:|..::|:.
Human  4464 KMGHLNSMN---IFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQL 4525

  Fly  4379 WTKLAY-PSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNE- 4441
            |.:::: .|.||.  ||::|:.|..:...|:.:.| |:..|:.||||||..|||:.|:..|.:: 
Human  4526 WKRVSWDSSTLGF--WFTELLERNAQFSTWIFEGR-PNVFWMTGFFNPQGFLTAMRQEVTRAHKG 4587

  Fly  4442 WPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIK 4506
            |.||.:.::.:|.::.|||:|:.|.||.||.||:|:||.||.:.|.:.::..|.||..:|||:|.
Human  4588 WALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIF 4652

  Fly  4507 AVTQDKQDIKNVYECPVY-KIRLRGPTFVWTFNLKSRERASKWTLAGVCLL 4556
            |:.........:|.||:| |.|....||:....|::......|.|.||.||
Human  4653 AINSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALL 4703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 113/598 (19%)
DHC_N2 1368..1770 CDD:285579 111/420 (26%)
P-loop_NTPase 1903..2132 CDD:304359 137/230 (60%)
P-loop_NTPase 2217..2352 CDD:304359 55/136 (40%)
P-loop_NTPase 2510..2783 CDD:304359 79/277 (29%)
P-loop_NTPase 2860..3127 CDD:304359 116/279 (42%)
MT 3140..3480 CDD:289543 103/352 (29%)
AAA_9 3509..3722 CDD:289547 91/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 218/701 (31%)
DNAH8NP_001193856.1 DHC_N1 354..910 CDD:285571 113/606 (19%)
CKAP2_C <915..>1047 CDD:291943 21/148 (14%)
DHC_N2 1488..1891 CDD:285579 111/409 (27%)
P-loop_NTPase 2025..2256 CDD:304359 139/234 (59%)
P-loop_NTPase 2340..2476 CDD:304359 56/137 (41%)
P-loop_NTPase 2644..2908 CDD:304359 79/267 (30%)
P-loop_NTPase 2998..3269 CDD:304359 116/278 (42%)
MT 3282..3628 CDD:289543 102/351 (29%)
AAA_9 3657..3873 CDD:289547 91/216 (42%)
Dynein_heavy 4014..4696 CDD:281078 219/711 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.