DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH6

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001361.1 Gene:DNAH6 HGNCID:2951 Length:4158 Species:Homo sapiens

Alignment Length:4433 Identity:1345/4434 (30%)
Similarity:2209/4434 (50%) Gaps:635/4434 (14%)


  Fly   469 LEEY--NSIYREWTNIQ-------YNPIDPDAENSLFQRDRLSFKAKTDVMER------------ 512
            :|||  ||......||:       ....:.:::..:     |:|:..|...|:            
Human    15 IEEYAENSALSRLNNIKAKQRVSYVTSTENESDTQI-----LTFRHITKAQEKTRKRQQPIKLEP 74

  Fly   513 ---MVSFQFEKGLEDTHD-----LLLAGSLLLRP--IIKKHVEPLMHVIVDDFEEEIMCVKKEFI 567
               :..:|..|..|..|:     |:.|| ::.||  |.||.    .......|.|....|||..|
Human    75 LPVLKVYQDHKQPEYIHEQNRFQLMTAG-IIKRPVSIAKKS----FATSSTQFLEHQDAVKKMQI 134

  Fly   568 N--FKNVF---------TALGLNEL--PTDDCFPK-------------VSGAISFLKKLRHRIIG 606
            :  :..||         |.:|...|  .....:||             :...:..:|.:|     
Human   135 HRPYVEVFSPSPPKLPHTGIGKRGLFGTRSSAYPKYTFHDREEVVKANIRDPLQIIKIIR----- 194

  Fly   607 LHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVE---CWQGIQQDITLTLIEK 668
             ..||..:.|.:....|.....|.:|:.|...::..|.  |.:|:.   ......:||....|::
Human   195 -ENEHLGFLYMIPAVPRSSIEYDTYNLKVVSYENINKN--DYYTISQRAVTHIYNEDIEFIEIDR 256

  Fly   669 DEANEL-RVNFTERLIFAL-----------KDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLM 721
            .|...| ....|:..||:|           |:::..::.||..|:....|....    ..|..|:
Human   257 WEQEYLYHRELTKIPIFSLFRKWKAFSVWRKNVRSKKITGCQKSLQKNLFIVNP----HLRPALL 317

  Fly   722 RIAE-WYNDTF------ERAHP-TEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVK 778
            :|.| .|:.:|      |:.|. |.:...||::|.:.|..:.|.:|              ....|
Human   318 KINELCYHLSFMGLCYIEKCHTYTLQEFKAAQVIRLAEVTERLGEF--------------RNEAK 368

  Fly   779 YLHDRLVAAQENLEAIKESIRSWGKVP---LFQRKDLNPALLLHTDPREPILSIRAANAADTQRL 840
            |:..|         |.:.::|:.|.||   .|             .|.|....::::.:      
Human   369 YVVRR---------ACRFALRAAGFVPDDCAF-------------GPFEDYHKVQSSGS------ 405

  Fly   841 IDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLE 905
                       |.:.|  :.||  .:|:.::              ||..:...||..........
Human   406 -----------FINTP--HELP--TYGDSEK--------------MTYTEQASKRHYCMRLTCFI 441

  Fly   906 EFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSST------- 963
            ...:...|:...|:|......||..|:.:           :....:.:::...||...       
Human   442 RLNDYLIENTMHILTVNAVNSLLNHLTDK-----------LKRTPSADVIQKWITEEKPEVPDKK 495

  Fly   964 -YLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVA 1027
             .|.:|.....|:..|:|...:.|...::::..:|:.        |::.||..:|:..:.:    
Human   496 GTLMVEKQEEDESLIPMFLTELMLTVQSLLFEPSLED--------FLDGILGAVNHCQNTV---- 548

  Fly  1028 QDPTEVTNMNPYSFYD---------ELQDKS-----------ELDKQRVEIMNKIKLALQA---- 1068
               ..|.|:.|.|::|         :|:.|:           |.||....|:::||..:||    
Human   549 ---LSVPNLVPDSYFDAFTSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQIKETIQAAFES 610

  Fly  1069 VRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKE 1133
            .|::...|.:|...              |..|.:||             ::.|.|:.|.::.:.|
Human   611 ARIYAATFEKFQIF--------------FKENESLD-------------LQALKLQEPDINFFSE 648

  Fly  1134 QLDKFIE----------------------------LQDQIRTWETYEDFFVFLRLNMTGFKV-AV 1169
            ||:|:.:                            :...:|..|...    |:....:..|| |:
Human   649 QLEKYHKQHKDAVALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLN----FMLPRQSKKKVDAI 709

  Fly  1170 LSQVGQWISLFKLDLINRVKNS-------LKELQDFV----DEANIV---------LKIELQKDD 1214
            :.:...  :.:||:.:......       |.|:|:.:    ||.|||         .::....:|
Human   710 IFEAQD--AEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPED 772

  Fly  1215 FEGLV----KILSVLNQINE---------KQ-CIYDSMFDPLKEIIDLLRQYNYEFKDTELAQIN 1265
            |....    .|::|.|.|::         || |::  :...|:|:.:.:.:...:.:|.::..|:
Human   773 FAVFATMKPSIVAVRNAIDKSVGDRESSIKQFCVH--LGSDLEELNNEVNEVKLQAQDPQILDIS 835

  Fly  1266 ELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYEL 1330
            ...|   |::.:....:.::|.:|        ||..    ...:|:|.|..:       :|.:|.
Human   836 ADQD---KIRLILNNLQSVLADLQ--------KRAF----QYKSYQKNFKVE-------VSKFEA 878

  Fly  1331 IDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKT 1395
            ::|...|                                  |||.:::||..........:|.|:
Human   879 LEEVSAE----------------------------------LKLKQLLWDSFSEWDKLQQEWLKS 909

  Fly  1396 PWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWI 1460
            .:..:|.|.::.:..|:.:.:..|:|.:........::..::.:...|..:.:|:||.::.|||.
Human   910 KFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWA 974

  Fly  1461 ELMQTTKVKFSMDDS---TTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEF 1522
            .:.||  |..::.|:   .||:.|..|::.::.:|:::|..::..|.|:|..|:.:..:|.|.||
Human   975 AIEQT--VDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEF 1037

  Fly  1523 GTDIH-DRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWF 1586
            ....| |...:.:|..::::...|:|....:..:|||:|:...:..|..||.:|:..:|.:..|.
Human  1038 VILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWL 1102

  Fly  1587 EVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG-SKLYEH 1650
            ..||.|.|||||| .:.||:.|||.:::.|..:||.:|.::.::|...|.:|:..:.| .:.:::
Human  1103 TCQRNWLYLESIF-NAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQN 1166

  Fly  1651 LEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLN 1715
            ...||..:   :|.|..|||:||:.:|||||:|:.:||:||:...||..|..||.|.:||:.||.
Human  1167 NNALLDQI---QKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLE 1228

  Fly  1716 L------------ISG------SKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTL 1762
            .            |.|      :.:...|::.| .|.|...:.....|.||.||.::.:.|..:|
Human  1229 FALMPPAEGKIPGIDGEPEKVYTNDILAMLSPE-GERVSLGKGLKARGNVEEWLGKVEEAMFTSL 1292

  Fly  1763 RDQLKRSLTFYDHKPRHVWIFE-WPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQIT 1826
            |...|.::..|..|.|..|:.. .|:|..|..:||||..:..:........:..|||::.|....
Human  1293 RRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFE 1357

  Fly  1827 QLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDD 1891
            :||.|..::.|.|....|..:..:.|||||:||:|..::..|||...:|.||.|||:.||..:|:
Human  1358 RLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDN 1422

  Fly  1892 CFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGR 1956
            |.|.:..:|:.|.|||||..|||||||||||||:.|..:|.|.:|||||||||||||||||||.:
Human  1423 CVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK 1487

  Fly  1957 ALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKK 2021
            ||.:...|||||:.:|||.:|....||||:|||.||||||||.:|||||:|.|:..|::|..:|.
Human  1488 ALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKL 1552

  Fly  2022 QTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQE 2086
            ..|.|.|..|.|..|...|||||||||||.|||:|||||:||.||:||::|||:|::|.:|||:.
Human  1553 SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFES 1617

  Fly  2087 ARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIP 2151
            :::||||...:|.||.|.||:|||||:|:||:|||||:||:|:|::....||.||:|||:|.|:|
Human  1618 SKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLP 1682

  Fly  2152 KIVTDDVPVFMGLIGDLFPALDVPRKRNPEFE-AVIKRSALDL----KLQPEDGFILKIVQLEEL 2211
            |.:|||..:|.|:|.||||.:.:     ||.: .:::.:.:|:    .||||...:.|::|..|.
Human  1683 KFLTDDALLFSGIISDLFPGVQI-----PEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYET 1742

  Fly  2212 FAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYND---------LNPKAVTNDELFGIVNP 2267
            ..|||.|.::|..|.||:.|::.|.:|..|.::....|.         ||||::|..||:|.||.
Human  1743 MLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGIENSFYQAVKTYVLNPKSITMGELYGEVNN 1807

  Fly  2268 STREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKE 2332
            .|.||||||.::.:|...|......|||:.||.:|.:|||::|||:||||:|.||::|||.||.:
Human  1808 LTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQ 1872

  Fly  2333 MRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWL----GTRTNSSEVSMLNVLFDKYV 2393
            :.:|||:..||.|:||||||.|:::::|::|.|.|::::|:    ...|..::..:|| ||.:||
Human  1873 IHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILN-LFQRYV 1936

  Fly  2394 PPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEI-------------YF 2445
            ...|.....:.....|..||:::...|.||:|::        ..||...:             .|
Human  1937 DEGLHFINKKCSQAIPQVDISKVTTLCCLLESLI--------LGKDGVNLAMEQTKLNTILCQTF 1993

  Fly  2446 VFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQF 2510
            |||.:|..|.:| .:...|..:.|.:...::....:.|.||.::|.::|.:||:..||..::|.|
Human  1994 VFCYLWSLGGNL-TENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTF 2057

  Fly  2511 ELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSAL-PSDKYSVT 2574
            :.:.|:|....||.|.:|.|..:.|:.|:...|.::..|.:|.||:::....|:.: .|..|...
Human  2058 KYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPV 2122

  Fly  2575 NVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFM 2639
            .:.|:..|:|...|.|:|..||:|.....|..||||::.||||:|||.:|:|.:..|..|:||:.
Human  2123 YLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQ 2187

  Fly  2640 DYHHWYDRQKMTLRDIHKCNIV-ACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILS 2703
            |:..:|||.|:..::|....|: ||..|..|...:.||..|||....:..||:.:|..|..:||:
Human  2188 DFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILN 2252

  Fly  2704 QHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSE 2768
            ..:.:    |..||.:...::|..::.::.|:....|||..|.||.|||||::....|:|..:..
Human  2253 GFLSD----FPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPG 2313

  Fly  2769 TCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVY--AQPLIYCHF 2831
            |.....|:.||:.|||.||:.|:|::..|.:.|..|::::..|.. |:..|:.|  .:|:|:..|
Human  2314 TIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHF-GIAIDLEYFLNKPIIFGDF 2377

  Fly  2832 AKGLTDIKYMPISGWDRLKSLLDEAQD------RYNDYIGAMN--------LVLFDDAMSHVCRI 2882
                  ||:    |.|:...:.|:..|      ...||:...|        ||.|.||:.||.||
Human  2378 ------IKF----GADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRI 2432

  Fly  2883 SRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKT 2947
            :|::...||.|||:||||:|||||||||:.|......||:|::.|:......::..||..|||:.
Human  2433 ARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVED 2497

  Fly  2948 SACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVD-NRENCWK 3011
            ....||.||:::..|:||..:|::|.||::..||..||:|.::.|.|...|::||.: ||:..::
Human  2498 KNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQ 2562

  Fly  3012 YFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLP 3076
            |||.|||..|.:|||.||||...|.|.|.||:||||.|||||.:||::||.|||..|.|::....
Human  2563 YFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDAGN 2627

  Fly  3077 KELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRL 3141
            :||...:......||.:|:.:::.|....:|..||||.|:||||.||..:|.||.|..:..|.|:
Human  2628 EELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRV 2692

  Fly  3142 ENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQ 3206
            :|||.||......||.::..|...|..|..|:::.:.|:..:..:.|...:.|....::|...:.
Human  2693 KNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKV 2757

  Fly  3207 IEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK 3271
            ..|:..|.|...:.|..:|.|||.||.:||::|:|.:::|::.|..|||.|::|..|:.:|.::|
Human  2758 KAEETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAK 2822

  Fly  3272 GKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAG 3336
                  ..|.:.:..:|: ..||..|:.|||::|.|.::..||.||.:.:|.|||:...|.|...
Human  2823 ------PDWPSAKQLLGD-SNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKS 2880

  Fly  3337 LCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALA 3401
            :|.||..::.:..|..|||||.:.|..::.|:......|......|.::|:|:.|||.|||:.:.
Human  2881 MCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVN 2945

  Fly  3402 KKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFT 3466
            :|:......:.|...:..|.:|...|..|::||.||::.....|..:.|::.|.:..::|.|.||
Human  2946 EKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFT 3010

  Fly  3467 RAYRQELQEKLWMPAFKNSQPPI-PSTDGV----DPFEMICDDAQIAEWNNQGLPSDRMSAENAA 3526
            ..|||.|.| .|:...::.:.|| ||...:    ||:|       |.:||..|||.|.:|.||..
Human  3011 AQYRQSLIE-CWIQDCQSLEIPIDPSFSLINILGDPYE-------IRQWNTDGLPRDLISTENGI 3067

  Fly  3527 ILVQSERYPLMIDPQLQGIKWVKTKYG-TGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENID 3590
            ::.|..|:|||||||.|..:|::.|.. :||.:::|:..|:|..:|.::..|..:|:|.:.|.:|
Human  3068 LVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLD 3132

  Fly  3591 PVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDG 3653
            |.|.|:|.:|:...|  .::::||.:||::..||..:.||:.||||.||:..:.|:||||||:.|
Human  3133 PALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSG 3197

  Fly  3654 LEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEK 3718
            ||||||::||::|:|.||..|.:|..:.|..|..||.:|:.:|..|.::..|:|::..|:..|:.
Human  3198 LEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQD 3262

  Fly  3719 TKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFN 3783
            :|.|:..|:.::.||:.|...|:.|||.|||.|.:.|::||::..|.:|:|:||:|||.|..:||
Human  3263 SKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFN 3327

  Fly  3784 NAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDF 3848
            ..:..::..|.|:.|::.|::.....::|..|||||||.|||:...||::::...|.:...|.:|
Human  3328 TTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNF 3392

  Fly  3849 LLR--------------FPYMPNQTSNFTW--------------------LTH---VGWGGIRAL 3876
            .||              .|::|..    ||                    |:|   :..|.....
Human  3393 FLRGSAGLEKERPPKPEAPWLPTA----TWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETY 3453

  Fly  3877 NNQAVFKGLEK-DIEGSHKRWKKFVDSESPENEKFPGEWK-GKSAIQRLCIMRCIRPDRMSYAMR 3939
            .|...::|..| ..|..|.|.:|....:.|        |. |.|:..:|.:::|.:.:::.:|:.
Human  3454 INPQKWEGYSKMKHEDKHMRQEKEAAHQDP--------WSAGLSSFHKLILIKCCKEEKVVFALT 3510

  Fly  3940 SFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSV 4004
            .|:.|.||.::|:...::....:::.|..|.:.|:||.|.||:...::..:..|:|   |...|:
Human  3511 DFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARESGYS---ERVQSI 3572

  Fly  4005 SLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSL---SNVHTSYRLFLSAEP 4066
            ||||||..:||..::.|.:.|:||.|||.||...|:.::|:.:::..   |.:..::|||||:.|
Human  3573 SLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMP 3637

  Fly  4067 AGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHA 4131
                 ::..|..:|::::|:|||||.|:.|||.:|....:....|......:::.|:|.:|:|||
Human  3638 -----SNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGKKWRQIIFGICFFHA 3697

  Fly  4132 VVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDR 4196
            ::.||:||||.|||..|.||..|...::..|..|.:.. ::||:.|.|:.|||.|||.:||.||:
Human  3698 IIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKEG-KIPWDALIYITGEITYGGRVTDSWDQ 3761

  Fly  4197 RLCRTYLEEFMQPELIDGELEYCQG--FPAPGILKYTGYHNYIDDNLP-SESPSLYGLHSNAEIG 4258
            |..||.|:.|..||.::.:.:|.:.  :.||.......:.:|| :||| .:.|.::|:|.||.:.
Human  3762 RCLRTILKRFFSPETLEEDYKYSESGIYFAPMADSLQEFKDYI-ENLPLIDDPEIFGMHENANLV 3825

  Fly  4259 FLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFN---------ILEL 4314
            |....:..|...:.|:|||   .|:|||..|.::|::.::..:..:.|....         :.:|
Human  3826 FQYKETSTLINTILEVQPR---SSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDL 3887

  Fly  4315 MGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQW 4379
            .||:...:   .|..||.:|.|||:..:..||..|:..:.|.:.:|..||.:......:|||..|
Human  3888 QGRLNSLT---TVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALW 3949

  Fly  4380 TKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPL 4444
            :..||||:..|.||..||:||...::.|:.. ..|.|.|::|||.||..||..:|..|||...|:
Human  3950 SNTAYPSLKPLGSWVKDLILRTSFVDLWLKR-GQPKSYWISGFFFPQGFLTGTLQNHARKYNLPI 4013

  Fly  4445 DRMCLNCDVTKKWKEELTT--------------------APREGAYINGLFMEGARWDMKMGTIA 4489
            |.:.....|...::::...                    :|.:|..::|:||:.:|||.|...|.
Human  4014 DELSFKYSVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPEDGVLVHGMFMDASRWDDKEMVIE 4078

  Fly  4490 DAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERA 4545
            ||...::.|.:||::.:. .|:.:....:|.||:||...|..|         ||.|..|.|:...
Human  4079 DALPGQMNPVLPVVHFEP-QQNYKPSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSK 4142

  Fly  4546 SKWTLAGVCLLLQ 4558
            ..|...|..||.|
Human  4143 DYWIAKGSALLCQ 4155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 77/374 (21%)
DHC_N2 1368..1770 CDD:285579 118/425 (28%)
P-loop_NTPase 1903..2132 CDD:304359 143/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 64/144 (44%)
P-loop_NTPase 2510..2783 CDD:304359 90/275 (33%)
P-loop_NTPase 2860..3127 CDD:304359 119/276 (43%)
MT 3140..3480 CDD:289543 104/340 (31%)
AAA_9 3509..3722 CDD:289547 86/216 (40%)
Dynein_heavy 3864..4549 CDD:281078 222/754 (29%)
DNAH6NP_001361.1 Stem. {ECO:0000250} 1..1433 349/1635 (21%)
DHC_N2 882..1300 CDD:285579 119/459 (26%)
P-loop_NTPase 1434..1664 CDD:304359 143/230 (62%)
AAA 1. {ECO:0000250} 1434..1655 139/221 (63%)
AAA 2. {ECO:0000250} 1715..1948 90/234 (38%)
P-loop_NTPase 1748..1893 CDD:304359 65/145 (45%)
P-loop_NTPase 2057..2328 CDD:304359 90/275 (33%)
AAA 3. {ECO:0000250} 2058..2306 82/252 (33%)
AAA 4. {ECO:0000250} 2408..2659 106/251 (42%)
P-loop_NTPase 2409..2678 CDD:304359 117/269 (43%)
Stalk. {ECO:0000250} 2676..2961 88/292 (30%)
MT 2690..3022 CDD:289543 104/340 (31%)
AAA 5. {ECO:0000250} 3042..3272 92/237 (39%)
AAA_9 3050..3266 CDD:289547 86/216 (40%)
Dynein_heavy 3407..4146 CDD:281078 225/769 (29%)
AAA 6. {ECO:0000250} 3509..3730 77/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.