DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH5

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_005248319.2 Gene:DNAH5 HGNCID:2950 Length:4660 Species:Homo sapiens

Alignment Length:4733 Identity:1374/4734 (29%)
Similarity:2338/4734 (49%) Gaps:501/4734 (11%)


  Fly    84 YFIR-----YLTPLHLTDENMLNSLLIGDLLPNPLAN-LSILCDEVFFPLLNNTVNQVGWTNVIA 142
            :|||     .:||.::..|...|.|   |.....|.| :..|..::|.|.|..|.:  ||..:..
Human   165 FFIRTDPSKAITPDNIHQEVSFNML---DAADGGLLNSVRRLLSDIFIPALRATSH--GWGELEG 224

  Fly   143 -NDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPA-------IAMGDISVVNPLMKH 199
             .|.....||.   ::.::|.|             .|:..|..       :...||..:..| |.
Human   225 LQDAANIRQEF---LSSLEGFV-------------NVLSGAQESLKEKVNLRKCDILELKTL-KE 272

  Fly   200 SLEFMVV----KWLDSVEDLVN--IKAGEKIYSKENFPL-------PEAIFSFWESRLENLENLA 251
            ..:::.:    :.|..:||.:.  ||..|::.::.|..|       |.|....|:.||.....|.
Human   273 PTDYLTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLL 337

  Fly   252 EQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDEN 316
            |||....:|.:..||...:|....::|.:...:.::..||:|..|.|..|::..|...::|....
Human   338 EQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSM 402

  Fly   317 RSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPD---SIFQGDVDEAYKK 378
            ...|..|:..|.:::..|.|::|...:|..|....|.:|......:..:   ||:....|...:|
Human   403 MDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASIWNQPQDVVEEK 467

  Fly   379 LDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVR 443
            :...::..:.|:|.:::.:..||:     ..|::.:.:.:..|||:.:.|..||.::.|:|.|::
Human   468 ILSAIKLKQEYQLCFHKTKQKLKQ-----NPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLK 527

  Fly   444 DFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKT- 507
            .:..|:...:.|         ||.:..:|..|.......:||.:|....:  |.:|...|..:| 
Human   528 TYSVLQDSTIEG---------LEDMATKYQGIVATIKKKEYNFLDQRKMD--FDQDYEEFCKQTN 581

  Fly   508 ---DVMERMVSFQFEKGLEDTHDLLLAGSLLLRPIIKKH---------VEPLMHVIVDDFEEEIM 560
               :.:.:.:...|.| :::|:..|        .::||.         ::....:|::::..:|.
Human   582 DLHNELRKFMDVTFAK-IQNTNQAL--------RMLKKFERLNIPNLGIDDKYQLILENYGADID 637

  Fly   561 CVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRI---IGLHKEHELYEYPLFDNE 622
            .:.|.:...| ....|..|:       |.::|.|.:.::|.|||   :.|.::|.    .:....
Human   638 MISKLYTKQK-YDPPLARNQ-------PPIAGKILWARQLFHRIQQPMQLFQQHP----AVLSTA 690

  Fly   623 RGGYVSDIFNIMVQEIDDFTKMLLDKW---TVECWQGIQQDITLTLIEKDEANELRVNFTERLIF 684
            ....:...:|.|.:.:.:|..:....|   ..|...|::..:   |::.....||.|||..:::.
Human   691 EAKPIIRSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASL---LVKAPGTGELFVNFDPQILI 752

  Fly   685 ALKDIKVVRLLGCDVSVNLTKFFCREDELWQ--ARVKLMRIAEWYNDTFERAHPTEKRLIAAEMI 747
            ..::.:.:..:|.:||...|..|.:.|...:  :.:|:| :|| |.....:.....::||...:.
Human   753 LFRETECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMM-LAE-YQRVKSKIPAAIEQLIVPHLA 815

  Fly   748 LIEEQMKPLLDFIKWNAFS-QRFIVMIFKMVKYLH---DRLVAAQE-NLEAIKESIRSWGKVPLF 807
            .::|.::|.|..:.|.:.: :.::...|..:|.|.   ||:....| .::||.|.:.|   .||.
Human   816 KVDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSS---TPLC 877

  Fly   808 Q---------------RKDL--NPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNL------ 849
            |               .|||  |.|.:||.   :..|...|.|     .|:::|:.|.:      
Human   878 QLPQEEPLTCEEFLQMTKDLCVNGAQILHF---KSSLVEEAVN-----ELVNMLLDVEVLSEEES 934

  Fly   850 -KLFFDIPRRY---SLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEE 910
             |:..:....|   |....|.|..|..:..|.....:|.:.|..:.||:.|::.||         
Human   935 EKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEE--------- 990

  Fly   911 QSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSV---ITSSTYLRM----E 968
                ..|:::.|:.        |...||.:         :..|.::::   |.||..:..    .
Human   991 ----ARELLSHFNH--------QNMDALLK---------VTRNTLEAIRKRIHSSHTINFRDSNS 1034

  Fly   969 VDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKT-------------GFAFFIETIL------- 1013
            ..|..:|:.|||...:.|..||:|....|:...:|             |...:...:|       
Human  1035 ASNMKQNSLPIFRASVTLAIPNIVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQE 1099

  Fly  1014 ---------DDMNNMMSLLKRVAQDPTEVTNMN------PYSFYDELQDKSELDKQRVEIMNKIK 1063
                     :|.::.:.:.:...||..|:.::|      ..::|..:.:..|:.|....:...|.
Human  1100 RKMAALQSNEDSDSDVEMGENELQDTLEIASVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIIN 1164

  Fly  1064 LALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPL 1128
            ...:.|......|..::.:|...|                           ...:|....:.|.|
Human  1165 STKKEVITSMDCFKRYNHIWQKGK---------------------------EEAIKTFITQSPLL 1202

  Fly  1129 SVYKEQLDKFIELQDQIRTWETYEDFFV---FLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKN 1190
            |.::.|:..|..|:.:|..    |..:|   .:.|.....|.|:.::...|:.:.......:.::
Human  1203 SEFESQILYFQNLEQEINA----EPEYVCVGSIALYTADLKFALTAETKAWMVVIGRHCNKKYRS 1263

  Fly  1191 SLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYE 1255
            .::.:...::|.|  .|:.....|.:.:...::.|.:|.|:|...|....|::|...||.:|...
Human  1264 EMENIFMLIEEFN--KKLNRPIKDLDDIRIAMAALKEIREEQISIDFQVGPIEESYALLNRYGLL 1326

  Fly  1256 FKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFF 1320
            ....|:.:::.|..||.|:...|...:..:..:|.                  :::|:.:|....
Human  1327 IAREEIDKVDTLHYAWEKLLARAGEVQNKLVSLQP------------------SFKKELISAVEV 1373

  Fly  1321 FVPCLSCYELIDESDLE-LVALEERQRSLAESAVLFELQ-------------GPD---------P 1362
            |:.  .|::...:.||. .:|...:.:..::..::|:.|             |.:         |
Human  1374 FLQ--DCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPATQYP 1436

  Fly  1363 VKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWE 1427
            ..:|: :..|.|::.::....::..|:|.:....|.:::||.::.|..:|....|.|.:|::.|:
Human  1437 QLLEI-KKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQ 1500

  Fly  1428 PFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD---DSTTLKDLIDLNLHEY 1489
            .|:.::..:.:.......:..:.:.|:.:|||..:  ||....|:|   :|..|:::::..|.:|
Human  1501 AFLDLKKIIDDFSECCPLLEYMASKAMMERHWERI--TTLTGHSLDVGNESFKLRNIMEAPLLKY 1563

  Fly  1490 EEEVKNIVDKSVKEMAMEKQLRDIATAWG--TMEFGTDIHDRTSIKLL---KASEELIETLEDHQ 1549
            :||:::|...:|||..:|::|:.:...|.  |..||:   .:|..:||   .::.|:|..:||..
Human  1564 KEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGS---FKTRGELLLRGDSTSEIIANMEDSL 1625

  Fly  1550 GQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSR 1614
            ..|.::.|::|...|:.:::.|...|||:..||.||..||..|.|||::|:|. ||..|||::::
Human  1626 MLLGSLLSNRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGG-DIAKQLPKEAK 1689

  Fly  1615 RFDYIDKEFKALLAQMNADRNVVRST--NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYP 1677
            ||..|||.:..::.:.:...:||:..  :.:..:|..|   ||..|.:|:|:|..|||.|||.:|
Human  1690 RFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPH---LLDQLEICQKSLTGYLEKKRLCFP 1751

  Fly  1678 RFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLENCD 1742
            ||:|||...||:||...::...:..||..::|::..:.......:....::.:..|.:...:...
Human  1752 RFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVM 1816

  Fly  1743 CSGKVEVWLNRITDKMRDTLRDQLKRS----------LTFYDHKPRHVWIFEWPAQPALVGTQIM 1797
            ..|.||||||.:.::.:.:|...::::          ||.:        :..:|||..|:|.|::
Human  1817 AEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEF--------LSSFPAQVGLLGIQMI 1873

  Fly  1798 WTTETNDAF--AKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDV 1860
            ||.::.:|.  ||..::   .::..|:..:..||.||.:...||::.||.|..|:.||.||.||:
Human  1874 WTRDSEEALRNAKFDKK---IMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDI 1935

  Fly  1861 VGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYI 1925
            ...:....::....|:|..|.|..::...|....:|.|..|.|..|:||.|.|||||||||||||
Human  1936 FDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYI 2000

  Fly  1926 TLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWG 1990
            ||.|:|.:.|||||||||||||||||||:||.||..|.|||||:|||::.:|.|.|||||:|:||
Human  2001 TLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWG 2065

  Fly  1991 CFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFL-GEHIALRTTVGVFITMNPGYAGRAELP 2054
            ||||||||.:.||||.|.|:..|....|..|::|.|. |:::.:....|:|:|||||||||.|||
Human  2066 CFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELP 2130

  Fly  2055 ENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIK 2119
            ||||..:|..||:|||..:|..:.|.:.||.:..:|||||.|||.||:|.||||.|||:|||.|.
Human  2131 ENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNIL 2195

  Fly  2120 SVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEA 2184
            |||...||.:|.:....|..::||.|||.|:.|::.:|.|:|:.||.||||.:.:.:...||.||
Human  2196 SVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEA 2260

  Fly  2185 VIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYN 2249
            .|.|...:..|.....:.||::||.|...|||.:..:|.:|.||:....||.:. .....|||..
Human  2261 AISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRA-MTDCGKPHRE 2324

  Fly  2250 -DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVM 2313
             .:||||:|..::||.::.:|.:|.||:||.|.|...........||:|||.:|.:|||:||:|:
Human  2325 MRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVL 2389

  Fly  2314 DDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTN 2378
            ||||.||||:.:||.:....:::||..::..|:||||||.|:::::...|.|:|.::.:|..| :
Human  2390 DDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKR-S 2453

  Fly  2379 SSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIAR---LQMTCYLLDSMLTPQNVPNDCPKDW 2440
            ..|..:|..|:.:..|   |::|..::::....::..   :..:..:|..::..:....:..:..
Human  2454 PQEAEILRQLYTESFP---DLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQGGEVSQAH 2515

  Fly  2441 YEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKF--PLSG---TIFSFYI------- 2493
            ....|||.::|..|::|    .:|.......|..:.......  |.:|   |.|.:|:       
Human  2516 LGRLFVFALLWSAGAAL----ELDGRRRLELWLRSRPTGTLELPPPAGPGDTAFDYYVAPDGTWT 2576

  Fly  2494 --DHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKT 2556
              :..|:::...::..|::        .|.||...:..|..|.:.|:.:....::|||..|:.||
Human  2577 HWNTRTQEYLYPSDTTPEY--------GSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKT 2633

  Fly  2557 ILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMP 2621
            :::...:|....:.:.:.::.|:..||..|.||.:|..::|:.|..|||...|:|..|:||:|||
Human  2634 VIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMP 2698

  Fly  2622 EVDKYFTVQPHTLIRQFMDYHHWYDRQK----MTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFC 2682
            .::::.....:.::||.|:.:.:|:.:|    .::.||.  .:.|.::|..|...|..||:|.|.
Human  2699 IINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQ--FLAAMIHPGGGRNDIPQRLKRQFS 2761

  Fly  2683 SFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFH 2747
            .|....||:.::..|...|...|.... :.|.:.|......:|.....|........|||..|||
Human  2762 IFNCTLPSEASVDKIFGVIGVGHYCTQ-RGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFH 2825

  Fly  2748 YNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIV--- 2809
            |.|||||::.::.|:|.:.||.....|.:::||.|||.||..|:....:|:..|.|.:..:|   
Human  2826 YVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEE 2890

  Fly  2810 ----RKGIEGVNDDVVYAQPLIYCHFAKGLTDIK--------YMPISGWDRLKSLLDEAQDRYND 2862
                :|.:.....|..:...|.....|.|.|..:        |.||..:..||..|:.....||:
Human  2891 FGEEKKLLVDCGIDTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNE 2955

  Fly  2863 YI-GA-MNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTK 2925
            .| || |::|.|.|||.|:.:|||::.:.:|.|||:|||||||||||||||||:....|||.||:
Human  2956 SIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTR 3020

  Fly  2926 DYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIV 2990
            .|:.|:|..::..||..||.:.....|:.||:|:..|.||..:|::|:||::..||..||::.|.
Human  3021 SYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEIN 3085

  Fly  2991 NAVRNEVKQ--LGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWF 3053
            :.:.:.:|:  ...:...||...||:.:||..|.:||||||||...|.|:.|||||::..|||||
Human  3086 SDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWF 3150

  Fly  3054 HEWPQQALESVSLRFLSEITV-----LPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTP 3113
            ..||:.||.:||..||:...:     :.||:...:.:|...|.:...|    |....:|..:.||
Human  3151 SRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVD----YFQRFRRSTHVTP 3211

  Fly  3114 KSFLELIALYSKLLHEK-----VKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKN 3173
            ||:|..|..|..:..||     ..||     |:..||.||...::.|.||...|:.:|.||::.|
Human  3212 KSYLSFIQGYKFIYGEKHVEVRTLAN-----RMNTGLEKLKEASESVAALSKELEAKEKELQVAN 3271

  Fly  3174 QEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNT 3238
            .:||.::..|..:.:...|.:|...|.:...:.|.:.::....:.||....|:|||..|:.||.|
Human  3272 DKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQT 3336

  Fly  3239 LNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK---GKIPKDR-----SWKACRAFM--GNVDKF 3293
            :..:::..:::.|.||..::.:...||:||..|   .||..::     ||:.....|  ||   |
Human  3337 IRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGN---F 3398

  Fly  3294 LDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKE 3358
            |.||..:.|..|:.:||:.|.||....:::.|.........||||||...:..|:.:...|.|.:
Human  3399 LQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLK 3463

  Fly  3359 RALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRL 3423
            ..|:..|.....|...|......|.:.:.:|:.:|.||::|:.:||...::|.:....:..|:.|
Human  3464 ANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTL 3528

  Fly  3424 IGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPP 3488
            |.|||.||.||.|..:......::|.||:|:.:.|:||.|.|.:.:|..|... |....|..:  
Human  3529 ISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLND-WRKEMKARK-- 3590

  Fly  3489 IPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYG 3553
            ||....::..||:.|...|:|||.||||:|.:|.:|..|:.::.||||:||||.||..|:|.|..
Human  3591 IPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKES 3655

  Fly  3554 TG-LVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREI 3615
            .. |.:..|:.:.:.:.:|.::|.|..||||::||.:||.|:.:|.|..||.|:.  :|:||:|:
Human  3656 RNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEV 3720

  Fly  3616 DFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQ 3680
            |....|||.:.|||.||.|.||:.|:|::|:||||..|||||||..|:..|:.:||..||.|.:.
Human  3721 DVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMED 3785

  Fly  3681 QNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSARE 3745
            ....|..:|.|||:||.||:|...:::||.:|::.|..||:||:|:..|:..:..|.|||:||||
Human  3786 VTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSARE 3850

  Fly  3746 AYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCS 3810
            .|||.|.|.||:||::.::..:|.:||.||:.|..:|:.::.:::.:.....|:.|:|:.:|:..
Human  3851 EYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEV 3915

  Fly  3811 FVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR---------FPYMPNQTSNFTWLT 3866
            :.|.:|||:|:.|.:|...|.::|.:....|:..|...|::         .|..|::     |:.
Human  3916 YKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSK-----WIL 3975

  Fly  3867 HVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEW-KGKSAIQRLCIMRCIR 3930
            .:.|..:..|:....|..:...|..:.|.||.:.|.|:||.|..|..: |.....:||.::|...
Human  3976 DITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWC 4040

  Fly  3931 PDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFS 3995
            |||.....|.:|.:.:|.||.:...::..:|:|||.|.|.:..:||.|.||...:..|||.|...
Human  4041 PDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIE 4105

  Fly  3996 FDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSL-EKKMESSLSNVHTSYR 4059
            ..:     ||:|||||:.|...::.....|.|.:|||.||...::..| :..:|:.|  ||.::|
Human  4106 TRY-----VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETEL--VHDAFR 4163

  Fly  4060 LFLSAEPAGDPAAH-ILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAIL 4123
            |:::.|      || ..|..:|:.:||..|:||.|:.|.:.:.....|.:.|:: |..:::|.:|
Human  4164 LWMTTE------AHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDV-SSGSQWKPML 4221

  Fly  4124 FSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL---EANTRVPWEDLRYLFGEIM 4185
            :::.:.|:.|.||||||..|||..|.||..|...:|..:.|:|   :....|.|..:||:.|||.
Human  4222 YAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQ 4286

  Fly  4186 YGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPS-ESPSLY 4249
            |||.:|||:|:||..|:.:.:....:...:..:.||:..|.......|..|| .:||: :||.::
Human  4287 YGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYI-QSLPAYDSPEVF 4350

  Fly  4250 GLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTP---TPFNI 4311
            |||.||:|.:.:.:::.:...:..:||:.|   |||...::|.::..:.:|:|:|.|   .||.:
Human  4351 GLHPNADITYQSKLAKDVLDTILGIQPKDT---SGGGDETREAVVARLADDMLEKLPPDYVPFEV 4412

  Fly  4312 LELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVP 4376
            .|.:.::....|..|...||.:||..:::.::.:|.||.|.:.|.:.:|..:.|.:.|::..::|
Human  4413 KERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIP 4477

  Fly  4377 EQWTKLAY-PSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKN 4440
            ..|.|.:: .|.||.  ||::|:.|..:...||.:.| |...|:.||||||..|||:.|:..|.|
Human  4478 AWWKKASWISSTLGF--WFTELIERNSQFTSWVFNGR-PHCFWMTGFFNPQGFLTAMRQEITRAN 4539

  Fly  4441 E-WPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLY 4504
            : |.||.|.|..:|||..|::::..|.||.|:.||::|||.||.:...:.::..|.||..|||:.
Human  4540 KGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIR 4604

  Fly  4505 IKAVTQDKQDIKNVYECPVYKIRLRGP-TFVWTFNLKSRERASKWTLAGVCLL 4556
            |.|.....:| ...|.||:||..:|.. .::...:|::.:....|.|.||.||
Human  4605 IYAENNTLRD-PRFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALL 4656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 122/603 (20%)
DHC_N2 1368..1770 CDD:285579 113/422 (27%)
P-loop_NTPase 1903..2132 CDD:304359 140/230 (61%)
P-loop_NTPase 2217..2352 CDD:304359 54/136 (40%)
P-loop_NTPase 2510..2783 CDD:304359 78/277 (28%)
P-loop_NTPase 2860..3127 CDD:304359 114/276 (41%)
MT 3140..3480 CDD:289543 102/350 (29%)
AAA_9 3509..3722 CDD:289547 96/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 223/698 (32%)
DNAH5XP_005248319.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.