DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001028827.2 Gene:Dnah1 RGDID:621795 Length:4250 Species:Rattus norvegicus

Alignment Length:4325 Identity:1351/4326 (31%)
Similarity:2170/4326 (50%) Gaps:522/4326 (12%)


  Fly   550 VIVDDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELY 614
            ||.:||:|.:     |..:.......|...:.|.....|||......|.....|.|.:.:..:.|
  Rat   125 VIPEDFQERV-----EQQSIGTTTRLLTQTDFPLQSYEPKVQVPFQVLPGRCPRKIEIERRKQQY 184

  Fly   615 EYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQD--------ITLTLIEKDEA 671
                       ...||..::..|..|..|::.....::..|.|:|.        :.|.:.:.:|.
  Rat   185 -----------LRLDIEQLLANEGIDSNKLMPRHPDLQQPQTIEQGRDPLFPIYLPLKVFDNEEF 238

  Fly   672 NELRVNFTERLIFAL-------KDIKVVRLLGCD--------VSVNLTKFFCREDEL-WQARVKL 720
             :.|.. ||.|...|       |.:....||..|        .|..|...:|....| :....||
  Rat   239 -DCRTP-TEWLNMGLEPDAQYRKPVPGKALLPTDDALGHEDPKSQELDYRWCEVGVLDYDEEKKL 301

  Fly   721 MRIAEWYNDTFERAHPTEKR-LIAAEMIL-------IEEQMKPLLDFIKW-------------NA 764
            ..:.:           |:|| |:..||.:       ..|...||||...|             ..
  Rat   302 YLVQK-----------TDKRGLVRDEMGMPIVNGGVTPEGRPPLLDTQYWVPRIQLLFCAEDPRV 355

  Fly   765 FSQRFI-----------VMIFKMVKYL-----HDRLVAAQENLEAIKESIRSWGKVPLFQRKDLN 813
            |:||.:           ::::.:  |:     ..:.|..:::|..||:    |.......||  .
  Rat   356 FTQRVVQANALRKNTEALLLYNL--YVDCMPTEGQRVINEQSLSKIKQ----WALSTPRMRK--G 412

  Fly   814 PALLLHTDPREPILSIRAANAADTQRLIDLLMYVNL-------KLFFD-----IPRRYS---LPP 863
            |::|.|                    |..|...|||       |:.||     .|..:|   || 
  Rat   413 PSVLEH--------------------LSSLAREVNLDYERSMNKINFDQIVSSKPETFSFVTLP- 456

  Fly   864 GEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITP------- 921
                |::||.    .|...|..:....|::::         |:|......:..|:||.       
  Rat   457 ----EKEEEK----VPNQGLVSVPEYPFREQK---------EDFTFVSLLTRSEVITALSKVRAE 504

  Fly   922 ---------FH----RYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRY 973
                     ||    :|..|:...|.:...|.:.::::.:.....|..::.:|...:.....|.|
  Rat   505 CNKVTSMSLFHSNLSKYSRLEEFEQIQSQTFSQVQMFLKDSWISTLKVAMRSSLRDMSKGWYNLY 569

  Fly   974 ENNTPIFEI-----FMELQEPNVVY-----FRNLDTSSKTGFAFFIE-------TILDDMN---- 1017
            |.|..::.:     .|||    :.|     .|.|...|...||.||.       ..:|||:    
  Rat   570 ETNWEVYLMSKLRKLMEL----IKYMLQDTLRFLVQDSLGSFAQFIGDACCSVLECIDDMDWGED 630

  Fly  1018 ----------NMMSLLKRVAQDPTEVTNMNPYSFYD----ELQDKSELDKQRVEIMNKIKLALQA 1068
                      |.:.::..|. |.|.|....|...::    .|.||..|....|..:.  ||.::.
  Rat   631 LINSPYKPRKNPLFIVDLVL-DNTGVHYSTPLEQFEVILLNLFDKGILATHAVPQLE--KLVMED 692

  Fly  1069 VRVHGKGFMEFSSLWIWDKSTYLSE--VKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVY 1131
            :.:.|...:|         |..|.|  |::...|:|.....|..                ||..|
  Rat   693 IFISGDPLLE---------SVGLHEPLVEELRANITNAMHKAMI----------------PLQAY 732

  Fly  1132 KEQLDKFIELQDQ-----IRTWETY--------EDFFVFLR-------------------LNMTG 1164
            .::..|::||.:.     ::|::|.        |.....|:                   :|:..
  Rat   733 AKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVDN 797

  Fly  1165 FKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDE-ANIVLKIELQKDDFEGLVKILSVLNQI 1228
            .|.: ||:..:.::...||::  .||...|:....:| .:|..||..:.:..|.|.::...:..|
  Rat   798 VKQS-LSKKRKALATSMLDIL--AKNLHNEVDSICEEFRSISRKIYEKPNSIEELAELRDWMKGI 859

  Fly  1229 NEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAAT---TKQLIAPIQS 1290
            .||..|.:.....:....:::.::.|..      ..::..|.|      ||.   ||.|      
  Rat   860 PEKLVILEERIVKVMSDYEVMDEFFYNL------TTDDFNDKW------AANNWPTKIL------ 906

  Fly  1291 YQVDLIE----------KRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDL--ELVALEE 1343
            .|:|::.          ::|.|.|.  |.:::|....:.......:..|:....::  |:..:::
  Rat   907 GQIDMVRQQHVEDEEKFRKIQLMDQ--NNFQEKLEGLQLVVAGFSTHVEIARAHEIANEVRRVKK 969

  Fly  1344 RQRSLAESAVLF----ELQGPDPVKIELCRFDLKLVKIMWDFA--ITIQSTINDWKK-------T 1395
            :.:...:.|:|:    .:.|     :.:..:| ||.:::.:|.  :.:.:|.:||.:       .
  Rat   970 QLKDCQQLAMLYNNRERIFG-----LPITNYD-KLSRMVKEFQPYLDLWTTASDWLRWSESWMND 1028

  Fly  1396 PWKKIDIENMDQECKKFGRELRGLDKAMRTWEPF-------IFMEASLKNLMTSLRAVTELQNPA 1453
            |...||.|.::   |......:.:.|.::.::..       :.:.|.:......:..:..|:||.
  Rat  1029 PLSAIDAEQLE---KNVIESFKTMHKCVKQFKDIPACQDVALDIRARIDEFKPYIPLIQGLRNPG 1090

  Fly  1454 IRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWG 1518
            :|:|||..|.....:......:.|....:::||.:|.|.:..:.:.:.||.|:|:.|..:...|.
  Rat  1091 MRNRHWEVLSNEININVRPKANLTFARCLEMNLQDYIESISKVAEVAGKEYAIEQALDKMEKEWA 1155

  Fly  1519 TMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIG 1583
            ::.|....:..|...:||:.:|..:.|:||....|:|:.|.|...||..:..|:.:|....:::.
  Rat  1156 SILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLE 1220

  Fly  1584 SWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLY 1648
            .|...||.|.|||.|| .||||..|||.:|:|:..:::.::.::.....:|.|:...  |..:|.
  Rat  1221 EWLNCQRSWLYLEPIF-SSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVC--SDQRLL 1282

  Fly  1649 EHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGK 1713
            :.|....|:|.|.:|.|::||||||.::|||||:|..:||:|||...:|..|..||.|.::::.:
  Rat  1283 DSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAR 1347

  Fly  1714 LNLISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPR 1778
            | |.........|.:.|.|| |....:...|..||.||..:...|:.::.|.::.::..|....|
  Rat  1348 L-LFQEDLEITHMYSAEGEE-VKLSFSIYPSSNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLR 1410

  Fly  1779 HVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQIT-QLNNLIILLLGDLTA 1841
            ..|:..||.|..:.|.|..||.|       |.|..| :::......|:: ||::|:.|:.|.|:.
  Rat  1411 TEWVLSWPGQVTIAGCQTYWTLE-------VAQALEASSISSSLFPQLSKQLSDLVALVRGKLSR 1468

  Fly  1842 AERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYE 1906
            .:|..:..:..|:||::|||..:|.:.|.....|:|.||||:.|..  :|.:....:|:|.|.||
  Rat  1469 MQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTN--NDLYIRAVNAEFIYGYE 1531

  Fly  1907 YLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQM 1971
            ||||:.||||||||||||:|||.:|||..||||||||||||||||||||:||.:...|||||:|:
  Rat  1532 YLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQL 1596

  Fly  1972 DYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTT 2036
            |:.::|...||||..|||.||||||||.:|||||||.|:..||.|.:.:.:.|.|.|..|.|..:
  Rat  1597 DFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPS 1661

  Fly  2037 VGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLC 2101
            ..||||||||||||.|||:|||||:||.||:|||:|:|:||.|.:.||.||.:||:|..|.:.|.
  Rat  1662 CAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLS 1726

  Fly  2102 KELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIG 2166
            .|.||.|||||:|:||:|:|:..||.|:|::....|:.:.:||:||.|:||.:.:|:.:|.|::.
  Rat  1727 SEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVS 1791

  Fly  2167 DLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEV 2231
            ||||............:..|:::.....|:..:||::|.:||.|...|||.:.::|..|:|||..
  Rat  1792 DLFPTTKEEETDYGILDQAIRKACEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNC 1856

  Fly  2232 WKTLNKTYQNQKRKP----------HYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQAN 2286
            ::.|.....:.|.||          :|..||||::|..:|:|..:..|.||.||:|..|:|..|.
  Rat  1857 YRILAAAMTSLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFPSLIRAGAI 1921

  Fly  2287 LGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVS 2351
            ...|..||.:.||.:|.:|||::|||:||||.|.|:|.|.|.||:.|.::||:..|..|:|||||
  Rat  1922 ASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVS 1986

  Fly  2352 RAGILYINPQDLGWTPFIQSWLGTRTN--SSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIA 2414
            |.|::|:.|..||..||::.||....:  .........||.|::...:...||.::.:...::..
  Rat  1987 RCGMVYLEPSILGLMPFVECWLKHLPSIIKPYEEQFKTLFVKFLESSIAFVRTTVKEVVASTNSN 2051

  Fly  2415 RLQMTCYLLDSMLTP-------QNVPND----CPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSN- 2467
            .......|||....|       :.:|::    .| :..|.:|:|.:||..|::      .|.|: 
  Rat  2052 LTMSLLKLLDCFFKPFLPREGLKKIPSEKLSHIP-ELIEPWFIFSLVWSVGAT------GDHSSR 2109

  Fly  2468 -EFSKW----FLNEYKAVKFPLSGTIFSFYI--------------DHETKK--FFPWTNLVPQFE 2511
             .||:|    .:.|...:.||..|.::.:.:              |.|:|:  :..|.:....|.
  Rat  2110 LNFSQWLKIKMVFEQIKLAFPEEGLVYDYRLDDAGISSTEDDDEDDEESKQVAWVKWMDYSVPFT 2174

  Fly  2512 LDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAK-LSALPSDKYSVTN 2575
            :..|....:.:|.|.:|.::.:.:..||....|::.|||:|:|||:.::.| |..||.: |....
  Rat  2175 MMPDTNYCNIIVPTMDTMQMSYLLGMLITNHKPVLCIGPTGTGKTLTVSNKLLKNLPLE-YISHF 2238

  Fly  2576 VPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMD 2640
            :.|:..|::...|.:::..|:|:....:||...:..|:|:||:|||.::.|....|..|:||:||
  Rat  2239 LTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMD 2303

  Fly  2641 YHHWYDRQKM-TLRDIHKCNIVACMN-PSAGSFTIDPRLQRHF--CSF-AVNPPSQDALFHILNS 2700
            :..||||:.: ..:::...|.|..|. |..|...|.|||.|||  .|| .::..|:..:|.|   
  Rat  2304 HGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSI--- 2365

  Fly  2701 ILSQHMD---------NPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIA 2756
            ||...||         .|:..... ::.:.|.:|...|:::..:.|..|||..|.||.|||||::
  Rat  2366 ILGCWMDGLLGEKSYREPVPGAPN-IVHMTEPLVNATISIYAIITSQLLPTPAKSHYTFNLRDLS 2429

  Fly  2757 NIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVV 2821
            .:|.|:|.:......:..|::|||.||..||:.|:||:..|...|..:: ::..:.:....:.|.
  Rat  2430 KVFQGILMAEPAKVEDKVQLLRLWYHENCRVFRDRLVNEEDRGWFDGLL-EMKMEDLGVAFNKVC 2493

  Fly  2822 YAQPLIYCHFAKGLTDIK-YMPISGWDRLKSLLDEAQDRYNDYIGA-MNLVLFDDAMSHVCRISR 2884
            ..||::|..|....:|:| |..|:..:::..:::|..:.||....| :.||||.|||||:|||||
  Rat  2494 PFQPILYGDFMSPGSDVKSYELITSENKMMQVIEEYMEDYNQINTAKLKLVLFVDAMSHICRISR 2558

  Fly  2885 ILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSA 2949
            .|..:.|.|||:||||||:.|||||||.::..:.||::|:|:|.:|:.:.::..:.:|||::...
  Rat  2559 TLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQVELSKNYGMSEWREDVKKILLKAGMQNLP 2623

  Fly  2950 CCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFI 3014
            ..||.:|:::..|.||..:|::|.||||..|:..||.:.|||.:|..:::.|:...:.|....:.
  Rat  2624 ITFLFSDTQIKNESFLEDINNILNSGDIPNLYSADEQDQIVNTMRPYIQEQGLQPTKANLMAAYT 2688

  Fly  3015 EKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVL--PK 3077
            .:||:.:.:|||.||:|...|.|.|:||:||||.|||||:|||.:||:||:.|||.||..|  ..
  Rat  2689 GRVRNNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALQSVATRFLHEIPELECSS 2753

  Fly  3078 ELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLE 3142
            |:...:.:...::|::|......|||...|:||.||||:|||:.::|.|:.:|.......:.|::
  Rat  2754 EVIEGLIHVCVYIHQSVAKKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKHRMK 2818

  Fly  3143 NGLIKLASCTKEVDALQDVLKVQEVELKIKNQEA--DNLIIVVGTENEKVSKERAFASKEEKNVR 3205
            :||.||...:::|..:|:.|::....|    :||  |.|:.:     :::..:.|.|.:..|:| 
  Rat  2819 SGLDKLLRTSEDVAKMQEELEIMRPLL----EEAAKDTLLTM-----DQIKVDTAIAEETRKSV- 2873

  Fly  3206 QIEE----DVTAKAKLCEEDFLK----AQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCG 3262
            |.||    :..:||:...:|..|    |.|||.||..:|..||||::||:::...||..|..|..
  Rat  2874 QAEEIKANEKASKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIE 2938

  Fly  3263 AVLVLFSSKGKIPK-----------DRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPY 3316
            ||.::   ||..||           |..|:..:..:.:..:||::|..:||.:|...||||:|||
  Rat  2939 AVCIM---KGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPY 3000

  Fly  3317 ILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLR 3381
            |.:.||.|..|...|.|...:|.||..:::::.|...||||.:||.|::.:::..:..|......
  Rat  3001 IDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHH 3065

  Fly  3382 LTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQ 3446
            |.|:|:.::.||.:|.|.:.||::.:.:..:....:..|::||.|||.||:||.::|:.|...:.
  Rat  3066 LREVEDGISTLQAKYRECVTKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQDTVENLENMLD 3130

  Fly  3447 QLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAF------KNSQPPIPSTDGVDPFEMICDDA 3505
            .:.||:|:.:.|::|:|.||..||..|.| .|:...      ..|:|.:.||.|        :..
  Rat  3131 NIFGDVLVAAGFVAYLGPFTGQYRAALYE-YWVNQLTVYGVPHTSKPTLISTLG--------NPV 3186

  Fly  3506 QIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLSQRNYLDQ 3569
            :|..|...|||:|.:|.||..|...|:|:...||||.|..||:|. :..:||.|.:||.|::|..
  Rat  3187 KIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMEKESGLDVFKLSDRDFLRS 3251

  Fly  3570 VERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKK--GTVLKIGDREIDFNSRFRLILHTKLANP 3632
            :|.|:..|...|:||:||.:||.|.|:|.:|..|:  .||||:||..|.::..||:.:.|||.||
  Rat  3252 MENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNP 3316

  Fly  3633 HYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLA 3697
            ||.||:..:.||||||::..|||||||.:||..||||||..:.:|.......:..||.:||.:|.
  Rat  3317 HYSPEVSTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILY 3381

  Fly  3698 RLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILN 3762
            ||||:..|.::||.|:..||.:|..|.||:.||..|:.|...||..|..|.|.|.|..|::|.::
  Rat  3382 RLSSSEGNPVDDVELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVS 3446

  Fly  3763 DLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFL 3827
            ||..::|:||:||:.|..:|.:.:..:..|:.||.|:.|:...:||..:....|.|||:.||:|.
  Rat  3447 DLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFA 3511

  Fly  3828 TQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFT--WLTHVGWGGIRALNNQAVFKGLEKDIE 3890
            ..||::|::|.|::...|..:||....:...:.|..  ||:...|..|.||:|...|.....|..
  Rat  3512 FLLCVRIMMNEGKINQGEWRYLLSGGSIQTMSENPAPHWLSDRAWRDILALSNLPAFSTFSTDFV 3576

  Fly  3891 GSHKRWKKFVDSESPENEKFPGEWKG-KSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDAR 3954
            ....:::...||..|..|..||.|.. ....|:|.|:||:|.|:::.||:.|:...|..::|:.:
  Rat  3577 QHLPKFQAIFDSAEPHREPLPGIWNTYLDEFQKLLILRCLRGDKVTNAMQDFVANHLEPRFIEPQ 3641

  Fly  3955 SMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIE 4019
            :...|..|:||:..|.:.||||||.||..|:.|..:.:.||   :...::||||||...||..:.
  Rat  3642 TANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFS---KKLSAISLGQGQGPRAEAMMR 3703

  Fly  4020 IASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGILESA 4083
            .:.:.|.||..||.||...|:|:||:.:|. :...||..:||:|::.|:..     .|..||::.
  Rat  3704 NSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNK-----FPVSILQNG 3763

  Fly  4084 IKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSY 4148
            .|:|.|||.|:.||:.|:.::.||:.|..|.|..|||::|.|||.||....|||||||.|:|..|
  Rat  3764 SKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPY 3828

  Fly  4149 PFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELID 4213
            .|..|||.|.:..|..:|:....:|::.|:|..|||.|||.:|||||||.....||:|..|.::.
  Rat  3829 EFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLS 3893

  Fly  4214 GELEYCQG---FPAPGILKYTGYHNYIDDNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFEL 4274
            .|..|.:.   ...|......||.:|| .:|| ::.|.::|||.||.|.|....:..||..:.:|
  Rat  3894 PEHRYSKSGIYHQIPPTYDLNGYLSYI-KSLPLNDMPEIFGLHDNANITFAQNETFALFGAILQL 3957

  Fly  4275 QPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGR----VEDRSPYIIVAFQECERM 4335
            ||:  ..|.||:  |:|::::::.||||.:.|.|.::.|::.:    .|:....::|  ||..|.
  Rat  3958 QPK--SSSMGGQ--SREELVEDVAEDILVQVPKPVDLEEVVNKYPVLYEESMNTVLV--QEVIRY 4016

  Fly  4336 NNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLR 4400
            |.|:..:.::|:::...:||.:.:|..:|.:...||.:.|||.|...||||:..|.||..||:.|
  Rat  4017 NKLLMVITQTLSDMLKAIKGLVVMSLELELMSTSLYNNAVPELWKSKAYPSLKPLASWIMDLLQR 4081

  Fly  4401 LRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAP 4465
            |..|..|:.: .:||..|::|||.||:.||..:|..|||....:|.:..:..|......|:...|
  Rat  4082 LNFLHSWIKN-GIPSVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLSYASSEIAERP 4145

  Fly  4466 REGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRG 4530
            ..|.||.|||:||||||.....:|::..|||:..|.|:::..|...|...::.|.||:||...|.
  Rat  4146 STGCYIYGLFLEGARWDPFDFQLAESRPKELYTEMAVIWLLPVANRKVQNQDFYLCPIYKTLTRA 4210

  Fly  4531 PT---------FVWTFNLKSRERASKWTLAGVCLL 4556
            .|         :|....:.|.:....|...||.|:
  Rat  4211 GTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALI 4245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 52/258 (20%)
DHC_N2 1368..1770 CDD:285579 113/418 (27%)
P-loop_NTPase 1903..2132 CDD:304359 144/229 (63%)
P-loop_NTPase 2217..2352 CDD:304359 59/145 (41%)
P-loop_NTPase 2510..2783 CDD:304359 90/288 (31%)
P-loop_NTPase 2860..3127 CDD:304359 118/270 (44%)
MT 3140..3480 CDD:289543 115/361 (32%)
AAA_9 3509..3722 CDD:289547 97/216 (45%)
Dynein_heavy 3864..4549 CDD:281078 247/704 (35%)
Dnah1NP_001028827.2 DHC_N2 1001..1402 CDD:285579 110/409 (27%)
P-loop_NTPase 1528..1758 CDD:304359 144/230 (63%)
P-loop_NTPase 1842..1988 CDD:304359 60/146 (41%)
P-loop_NTPase 2173..2456 CDD:304359 90/288 (31%)
P-loop_NTPase 2533..2803 CDD:304359 118/270 (44%)
MT 2816..3162 CDD:289543 115/360 (32%)
AAA_9 3191..3406 CDD:289547 97/215 (45%)
Dynein_heavy 3545..4238 CDD:281078 248/709 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.