DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH2

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_024306372.1 Gene:DNAH2 HGNCID:2948 Length:4531 Species:Homo sapiens

Alignment Length:4621 Identity:1454/4622 (31%)
Similarity:2381/4622 (52%) Gaps:426/4622 (9%)


  Fly     2 ADEKEKKEP-VDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSG 65
            |..:|..|| .|.:|.|.       .|..|......:.|.|...::..|..:|.:..:...|:..
Human    64 AQSEESVEPEADVKPLFL-------SRAALTGLADAVWTQEHDAILEHFAQDPTESILTIFIDPC 121

  Fly    66 GQLYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFP-LLN 129
            ..|......||:.:.::.||||. .|:.:|.||...::..|.:....:..|..|...||.| :..
Human   122 FGLKLELGMPVQTQNQLVYFIRQ-APVPITWENFEATVQFGTVRGPYIPALLRLLGGVFAPQIFA 185

  Fly   130 NTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVN 194
            ||    ||...|.|...:...:....:...:..:...|:..:|.   |.|...|.:.:.|..:| 
Human   186 NT----GWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPA---EAMNMKPEMVIKDKELV- 242

  Fly   195 PLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENF-PLPEAIFSFWESRLENLENLAEQLGDRR 258
                ..||..::.|...::::  :.|.|.:.:.||. ||.|  ..||.:|..:|..:::||..:.
Human   243 ----QRLETSMIHWTRQIKEM--LSAQETVETGENLGPLEE--IEFWRNRCMDLSGISKQLVKKG 299

  Fly   259 IKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPL 323
            :|.:..:|...:|.:...:.::.:.:.:...:|:.....||.||....:.......:..|.:..|
Human   300 VKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLPKL 364

  Fly   324 MLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEY 388
            :..|.::|.:|.:::|...:|..|....|.:|......:..|.||:|.|..:.:.|...:.....
Human   365 ISLIRIIWVNSPHYNTRERLTSLFRKMSNEIIRLCCHAISLDRIFEGYVSSSKEDLQGCILCCHA 429

  Fly   389 YKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVM 453
            :|..|      ::..::...|:|:.|...|..||.::|.|:.|.::|.::.:....|.:.|....
Human   430 WKDHY------VQAVQMHIQFSSRGWVLDQTSIFAQVDAFVQRCKDLIEVCDCQYHFARWEDGKQ 488

  Fly   454 G------GLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKA---KTDV 509
            |      |.:|.|||..|.:|.:.::........::...:  |.:|:.:..|...|:|   ..:|
Human   489 GPLPCFFGAQGPQITRNLLEIEDIFHKNLHTLRAVRGGIL--DVKNTCWHEDYNKFRAGIKDLEV 551

  Fly   510 M-ERMVSFQFEKGLEDTHDLLLAGS---LLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFK 570
            | :.:::..||...:..|.:||..:   |..|..||:..:.....:...|..|:..|.:|    :
Human   552 MTQNLITSAFELVRDVPHGVLLLDTFHRLASREAIKRTYDKKAVDLYMLFNSELALVNRE----R 612

  Fly   571 NVFTALGLNELPTDDCFPKV---SGAISFLKKLRHRI---------------IGLHKEHELYEYP 617
            |       .:.|  |..|.|   ||...::..||.||               ||..|| .::.| 
Human   613 N-------KKWP--DLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGKE-SVHTY- 666

  Fly   618 LFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWT----VECWQGIQQDITLTLIEKDEANELRVNF 678
                          ..|||.||:..:....:||    .:|.:.:  |..|..|.:::|..|.|||
Human   667 --------------QQMVQAIDELVRKTFQEWTSSLDKDCIRRL--DTPLLRISQEKAGMLDVNF 715

  Fly   679 TERLIFALKDIKVVRLLGCDVS---VNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKR 740
            .:.|:....:|.....|..:..   ||:.:   |.::|...|..|:.:|..||.......|.|:.
Human   716 DKSLLILFAEIDYWERLLFETPHYVVNVAE---RAEDLRILRENLLLVARDYNRIIAMLSPDEQA 777

  Fly   741 LIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVP 805
            |....:.|:::::.|.|..:.|                              |:|      |...
Human   778 LFKERIRLLDKKIHPGLKKLHW------------------------------ALK------GASA 806

  Fly   806 LFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEED 870
            .|                  |...| .:|:..|.:::..            :..:|..|...:| 
Human   807 FF------------------ITECR-IHASKVQMIVNEF------------KASTLTIGWRAQE- 839

  Fly   871 EESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSES-----------EEEIITPF-H 923
                        :|....|:...||...|     .||||:|.|.           .::::|.. :
Human   840 ------------MSEKLLVRISGKRVYRD-----LEFEEDQREHRAAVQQKLMNLHQDVVTIMTN 887

  Fly   924 RYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEV--DNRYENNTPIFEIFMEL 986
            .||:.|....|.:..:..|.|.:|.::.:.|..:|..|...|...:  |.:...| |:|::.   
Human   888 SYEVFKNDGPEIQQQWMLYMIRLDRMMEDALRLNVKWSLLELSKAINGDGKTSPN-PLFQVL--- 948

  Fly   987 QEPNVVYFRNLDTS-SKTGFAFFIET---ILDDM-NNMMSLLKRVAQDPTEVTNMNPYSFYDELQ 1046
                |:...:|..| ::..|:..::|   :::|: |::.|.:......|..:|....:.  :.:|
Human   949 ----VILKNDLQGSVAQVEFSPTLQTLAGVVNDIGNHLFSTISVFCHLPDILTKRKLHR--EPIQ 1007

  Fly  1047 DKSELDKQRVEIMNKIKLAL----QAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERD 1107
            ...|.|:...:|..:|...:    ..::.:.|.:..:..:|..:|.:::...::..         
Human  1008 TVVEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLN--------- 1063

  Fly  1108 AEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQ 1172
                              ||:|.:...:.::.|:.:.::..||..: ..|:.|:.:..|.:::..
Human  1064 ------------------PPVSSFVADIARYTEVANNVQKEETVTN-IQFVLLDCSHLKFSLVQH 1109

  Fly  1173 VGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDS 1237
            ..:|.:.|...|.......|.||..::.|.  ..||.......|.|...|.:::.:.......::
Human  1110 CNEWQNKFATLLREMAAGRLLELHTYLKEN--AEKISRPPQTLEELGVSLQLVDALKHDLANVET 1172

  Fly  1238 MFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAP-IQSYQVDLIEKRIL 1301
            ...|:.|...:|.:|....:|:.|..::.|...|:..::....:||::.. .:.::..||     
Human  1173 QIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLI----- 1232

  Fly  1302 LCDNMANTYRKK--FLSKKFFF-------VPCLSCYELIDESDLELVALEERQRSLAESAVLFEL 1357
               :.|:.::||  .|.:.|.|       |..:|..:.|.:....|:|:.|.:.||..:..:|::
Human  1233 ---HSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKI 1294

  Fly  1358 QGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKA 1422
            :.|....::....:|..::.:|:.|...:...|:||...:..:..|.|:.......|.|..|.|.
Human  1295 EQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKE 1359

  Fly  1423 M--RTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD-DSTTLKDLIDL 1484
            .  |.||......:.::....::..:::|:|||:|:|||.::....:.:|..: :|.||:.:::|
Human  1360 YKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVEL 1424

  Fly  1485 NLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDI-------HDRTSIKLLKASEELI 1542
            .:.::.|::..|...:.||:|:|..|::||..|...:.  ||       |.|     |:.:||:.
Human  1425 GMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQL--DIVPYKDKGHHR-----LRGTEEVF 1482

  Fly  1543 ETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRS 1607
            :.|||:|..|..|.:|:::..||.:|..|:..||...::|.....|||:|.|||:||:| ||||.
Human  1483 QALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLG-EDIRK 1546

  Fly  1608 QLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCE---KALNDYL 1669
            |||.:|..||.::..:||::.:||.|.|.:|||:..|.     |:.|::|..:.|   |:|:.||
Human  1547 QLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGL-----LDTLIEMNTILEDIQKSLDMYL 1606

  Fly  1670 ETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL--ISGSKN---AAGMVAK 1729
            ||||..:|||||:|:.|||:||....||..|..||.|.:|::..|.:  :.|..:   |.||.:.
Human  1607 ETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSG 1671

  Fly  1730 ELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKR---SLTFYDHKPRHVWIFEWPAQPAL 1791
            : .||:.||.:....|.||.||..:...||.||||.|:.   :|..:.:| |..|:.||..|..:
Human  1672 D-GEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNK-RDKWVKEWAGQVVI 1734

  Fly  1792 VGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDV 1855
            ..:||.||.:........::|.: ..||...|.|::.||.....:.|:||...|.||:.:.||::
Human  1735 TASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEI 1799

  Fly  1856 HSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLT 1920
            |:|||:..:....:....:|.|.||||..|:..:|||.....:.||:|:||||||:.||||||||
Human  1800 HARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLT 1864

  Fly  1921 DRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQ 1985
            ||||:|||.:|||..||:|.||||||||||.||||:|||:.|.|.||||.:||||:|.::.||||
Human  1865 DRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQ 1929

  Fly  1986 TGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGR 2050
            |||||||||||||::|||||||.|:.||..|:.:....|.|.|..|.|..:.|:|||||||||||
Human  1930 TGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGR 1994

  Fly  2051 AELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGL 2115
            .|||||||:::||.||||||..||:||:|..|||...::||:|..|||:|..:.||:|||||:||
Human  1995 TELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGL 2059

  Fly  2116 RAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNP 2180
            ||:.|:|..||..||......:::||:.::||.||.|:.:.|.|:|..::.||||.:::|.....
Human  2060 RALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYG 2124

  Fly  2181 EFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKR- 2244
            :....:::...|:.||.....:.|:.||.|....|||..|:|..|:||:..|:.|..:..:..| 
Human  2125 KLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRA 2189

  Fly  2245 -KPHYN-----DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDP 2303
             .|::|     .|||||::..||:|..:.||.||.||:.|.:||..........|||:.||.:|.
Human  2190 GDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDT 2254

  Fly  2304 MWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPF 2368
            :|||::|:||||||||||.:.||||:.:::.||||:..|..|:||||||.|::|.:..||||.|:
Human  2255 LWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPY 2319

  Fly  2369 IQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVP 2433
            :||||..|. .:||..|..:|:|.:..:|...:...:.:.|:.:.:.:...|.|..::.||:|..
Human  2320 VQSWLEKRP-KAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGV 2383

  Fly  2434 NDCPKDWY----EIYFVFCIVWGFGSSLFQD--QIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFY 2492
            |....:.|    |:.|||.::|...:|:.::  :.||       .:|.|.:. .||...|::.::
Human  2384 NPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRID-------SYLREIEG-SFPNKDTVYEYF 2440

  Fly  2493 IDHETKKFFPWTNLVPQ-FELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKT 2556
            :|.:.:.:..:.:.:|: :....:.|....:|.|.:|.|..:.:.:|:...:|::|:||.|:|||
Human  2441 VDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKT 2505

  Fly  2557 ILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMP 2621
            .:..:.|.:|||.::||..|..:..|||..:|.|:|..:||:....|.|.|.|.||.|:||:|||
Human  2506 SIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMP 2570

  Fly  2622 EVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFA 2685
            ..|.:.:..|..|||.::||..||||.|.|::.|.:..::|.|.|..|..| |.|||:..|....
Human  2571 AKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIIN 2635

  Fly  2686 VNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTA-ITLHLKVVSSFLPTAIKFHYN 2749
            :..|::..:..|..::::|    .:|.|::.| |...|:||.| :.::..||..||||..|.||.
Human  2636 MTFPTKSQIIRIFGTMINQ----KLQDFEEEV-KPIGNVVTEATLDMYNTVVQRFLPTPTKMHYL 2695

  Fly  2750 FNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIE 2814
            ||||||:.:|.|:|.:|.:.....:.:.|||||||:||:.|:|||..|..:|..|:||.:     
Human  2696 FNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKL----- 2755

  Fly  2815 GVNDDVVY------AQPLIYCHFAK------GLTDIKYMPISGWDRLKSLLDEAQDRYN--DYIG 2865
            |...|:.:      .:|.|:..|.|      .|||:..        ||::::.|.:.||  ..:.
Human  2756 GSFFDLTFHHLCPSKRPPIFGDFLKEPKVYEDLTDLTV--------LKTVMETALNEYNLSPSVV 2812

  Fly  2866 AMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVS 2930
            .|.||||.:|:.|:.||.|::...||..||:|:||||:|||.||||.|.....|||::||.|...
Human  2813 PMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQ 2877

  Fly  2931 DLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRN 2995
            :.:.:|..||.:|||:.....|:..|:::|.|.||..:|::|:||::..|:..||.|.|.:.:.:
Human  2878 EFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIID 2942

  Fly  2996 EVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQA 3060
            :.:...:.::.::.:.|.||:|::.|.:|||.||:|...|...|::|||||||||:||.||||:|
Human  2943 QARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEA 3007

  Fly  3061 LESVSLRFLSEITVLPKE-LALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYS 3124
            |..|:.:.|..:.:..:| :...|:.....:|.:|...|:..|...:|:||.||..:|||::.|.
Human  3008 LLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYK 3072

  Fly  3125 KLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKI---KNQEADNLIIVVGTE 3186
            |||.||.:..|.:..:|..||.|:....::|..:.  |::::.:.|:   :.|..:.|:|:|..:
Human  3073 KLLGEKRQELLAQANKLRTGLFKIDETREKVQVMS--LELEDAKKKVAEFQKQCEEYLVIIVQQK 3135

  Fly  3187 NEKVSKERAFASKEEKNVRQIEE-DVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSF 3250
            .|...:::|..:..||..  :|| ...|.|...::|..:|.|||..|..||.:|||.::.|:||:
Human  3136 READEQQKAVTANSEKIA--VEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSY 3198

  Fly  3251 GSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQP 3315
            |.||..|..|..||::|   :|..|   :|...:..:|. ..|:.:|||:||.:|...|:|.:..
Human  3199 GRPPAQVEIVMQAVMIL---RGNEP---TWAEAKRQLGE-QNFIKSLINFDKDNISDKVLKKIGA 3256

  Fly  3316 YILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNL 3380
            |....:|.|:.|...|.||..||.||..:..:..:|.|||||...:..:..::::.:..|.....
Human  3257 YCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQE 3321

  Fly  3381 RLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGI 3445
            :|.|:.|:|..|:.:|||.||:|::.:.::.:....::.|..|:.|||.||.||.|:|:.|...:
Human  3322 KLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDL 3386

  Fly  3446 QQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEW 3510
            ..|.||.|:.:.|:||:|.|...||.|:..::|:......|.|...:..:|.|  :|:..::.:|
Human  3387 GYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNF--LCNPTKVRDW 3449

  Fly  3511 NNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLSQRNYLDQVERAV 3574
            |.||||||..|.||..|:.:..|:.||||||.|.:||:|. :.|.||.::.|...:||..:|.|:
Human  3450 NIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAI 3514

  Fly  3575 SNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPE 3637
            ..|..:|::|:.|.:||.|||:|.:.:.:.|  .:::|||:|:::|:.||..:.|||:||||.||
Human  3515 HFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPE 3579

  Fly  3638 MQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSA 3702
            ..|:||::||.|...|||.|||..||:.|||:||..:..|.......|..||.|||::|..|:.|
Human  3580 TSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEA 3644

  Fly  3703 GDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKI 3767
            ..::|:||.||..|..:|.||.|:..::..::.|.:..|.|||||||.|:||||::|:|||:..|
Human  3645 TGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCI 3709

  Fly  3768 NPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCI 3832
            :|:|||||.|:..:|..::.|:..:.||:||::.|.|..|:..:.||.|.|||:.||:|...:|.
Human  3710 DPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCA 3774

  Fly  3833 QILVNLGEVEPTELDFLL-------RFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIE 3890
            :||...|::...|.:|.|       |...|.|..|  :||....|..|..|:....|.||....|
Human  3775 KILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCS--SWLADAYWDNITELDKLTNFHGLMNSFE 3837

  Fly  3891 GSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDAR 3954
            ...:.|..:..:.:||....||||:.. :.:||:.|:|.:|.||:::.:.|||...|||::|:..
Human  3838 QYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPP 3902

  Fly  3955 SMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIE 4019
            .:......|:|:|.:.:.|:|||||||...:.:|.:.:|.:   :.||::||||||..:|...:.
Human  3903 VLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMA---QRFHALSLGQGQAPIAARLLR 3964

  Fly  4020 IASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGILESA 4083
            .....||||.|.|.||...|:|:|:|.:|. .:.:.|.|:||:||:.|..|     .|..||:.:
Human  3965 EGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPD-----FPISILQVS 4024

  Fly  4084 IKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSY 4148
            ||:|.|||.|:.||:.:.....|:.....|||..::|.:|||||:||:|:.||:||...|||..|
Human  4025 IKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIY 4089

  Fly  4149 PFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELID 4213
            .||..|..:|..:|..||:.....||:.|:||...|.||||:||||||||..||:.::...:.:.
Human  4090 GFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLS 4154

  Fly  4214 GELEYCQG-----FPAPGILKYTGYHNYIDDNLPS-ESPSLYGLHSNAEIGFLTTVSERLFRIVF 4272
            ........     .|..|.|  ..|..|| ..||. :.|..:|.|.||::....|.::.||..:.
Human  4155 TPFHRLSALETYFIPKDGSL--ASYKEYI-SLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLL 4216

  Fly  4273 ELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVE----DRSPYIIVAFQECE 4333
            .|||::|...:||:|  :|:.:..:..|:..|.|   .:::..|..:    |.||..:|..||.:
Human  4217 SLQPQITPTRAGGQT--REEKVLELAADVKQKIP---EMIDYEGTQKLLALDPSPLNVVLLQEIQ 4276

  Fly  4334 RMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLM 4398
            |.|.||..:..||.:|:.|::|.:.:|:.:|::..|::...||..|.| ||||...|.:|..||.
Human  4277 RYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGK-AYPSQKPLAAWTRDLA 4340

  Fly  4399 LRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTT 4463
            :|:.:.|.|.:..|.|...||:||..|...|||::|.:||:|...:|.:.....|:......|..
Human  4341 MRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDDSNLVY 4405

  Fly  4464 APREGA 4469
            .|:.||
Human  4406 PPKVGA 4411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 133/605 (22%)
DHC_N2 1368..1770 CDD:285579 140/423 (33%)
P-loop_NTPase 1903..2132 CDD:304359 148/229 (65%)
P-loop_NTPase 2217..2352 CDD:304359 63/142 (44%)
P-loop_NTPase 2510..2783 CDD:304359 100/275 (36%)
P-loop_NTPase 2860..3127 CDD:304359 105/270 (39%)
MT 3140..3480 CDD:289543 108/344 (31%)
AAA_9 3509..3722 CDD:289547 94/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 214/619 (35%)
DNAH2XP_024306372.1 DHC_N1 242..799 CDD:312031 133/608 (22%)
SMC_N <1005..>1537 CDD:330553 123/577 (21%)
DHC_N2 1309..1710 CDD:312039 140/415 (34%)
MT 1374..4190 CDD:330758 1084/2884 (38%)
Dynein_heavy 3810..4411 CDD:308587 213/618 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.