DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah11

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_034190.3 Gene:Dnah11 MGIID:1100864 Length:4488 Species:Mus musculus

Alignment Length:4624 Identity:2180/4625 (47%)
Similarity:3042/4625 (66%) Gaps:230/4625 (5%)


  Fly     2 ADEKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGG 66
            |..:.::..:|.|..|....|.:.:|...:.|.:.:.:::.|.|:.:||.:.....::|::.:.|
Mouse    27 AARRVQRFALDPRVRFLGGRLRQALRFPEETWGQYLESDDHRQVLGDFLESTGPASLVFSVATAG 91

  Fly    67 QLYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNT 131
            :|..|...|...::|:.||.:.:|. ::.:.:...::|.|::..:.|.:::...||:..|:|:|.
Mouse    92 RLSASPEIPRDVKHKLVYFAKKMTE-NMGESDFSQTILFGEIPRSLLTHVTAFLDEILVPVLSNK 155

  Fly   132 VNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDIS----V 192
            .|...|:..|:.|::..::.|:|.:...:|.:..||..|:|...:.:          |:.    |
Mouse   156 NNHTSWSCFISQDVEHHTEVMKNKMHIFRGKMSRRTHLPIPTIAENI----------DLDQHYLV 210

  Fly   193 VNP-----LMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAE 252
            ..|     .:.|::|.:|:||...:::::...:...:.|..: |.||....||..|.:||:.:..
Mouse   211 TRPQSDERRILHAIESLVIKWSHQIQEIIEKDSAHPLLSGLH-PTPETELDFWTMRHDNLKCIYS 274

  Fly   253 QLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENR 317
            ||....:..:..:|...||.:..:.:.|...|..:|.||:|:...|.||:|.:...:..:..:.|
Mouse   275 QLQAPIVLKMVKILRTRQSSYLPALKGIFTTVENALLEAQDVELHLRPLRRHIHSLQEAEFPQTR 339

  Fly   318 SDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDIN 382
            ..|.||:.||.|:|.||::::|...:.:....|.|..||.....:.|:.:.:|::::|.:|:.:.
Mouse   340 ILIAPLLHTICLIWSHSKFYNTPARVIVLLQEFCNLFIDQARAYLSPEDLLKGEIEDALEKVQVA 404

  Fly   383 MQHLEYYKLIYNECRNSLKKFKIGTT------FNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNT 441
            :..|:.:       :||..|::.|.|      ...:.|.:....:|||.:|||.||.:::|:|.|
Mouse   405 ISVLKTF-------QNSFFKYRKGLTSYFTRNTEQRSWDFQSHLVFGRFNKFLDRLVKIEDMFVT 462

  Fly   442 VRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAK 506
            :.:|:|||::..||.||..:...:....||:....:.:....|:|  .|.::..|:.|...||::
Mouse   463 ILEFEKLERLEFGGSKGAVLNAQIHSTSEEFIECCKVFQQSTYDP--SDCDDMEFESDYFKFKSR 525

  Fly   507 T-DVMERMVSFQFE-----KGLEDTHDLL-LAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKK 564
            | |...|:.:...|     .|||....|| :.|:.|.:|::.:...|....:::.|..|:...|:
Mouse   526 TLDFDRRLGTLLCEGLSNCSGLESAFKLLTIFGNFLEKPVVMEMFSPHYSTLLNMFNAELDVCKQ 590

  Fly   565 -------------EFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRI-------IGLHK 609
                         |.:| ||:               |..||.|.:.:.|..|:       ..|| 
Mouse   591 LYDEHMKQIEHGHEILN-KNM---------------PFTSGNIKWARMLLERLQMFWSNFTSLH- 638

  Fly   610 EHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDEANE- 673
                |.:|  |:.....|...:..|...:|.|...:..:|.....:..:.::...|::....|. 
Mouse   639 ----YLFP--DSPDEAAVCQKYAEMTTLLDQFESHIYSEWRRNVDETCEFNLNQPLVKFSPINGL 697

  Fly   674 LRVNFTERLIFALKDIKVVRLL-GCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPT 737
            |.|||..:|:..|:::|.:.:| ..|:..:....|.:.:.:.:....|..:.:.||...:.....
Mouse   698 LSVNFDPKLVAVLREVKYLLMLKKSDIPDSALGIFQKRNIILKYIGNLELLVQGYNKLKQTLLEV 762

  Fly   738 EKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWG 802
            |..||..|:..|:||::....::.|......::..:......|..|:...|.|:..|::::::|.
Mouse   763 EYPLIEDELGAIDEQLRVAATWLTWQDDFWVYMERVQVATAELECRVSQTQSNMLTIQQTMQAWA 827

  Fly   803 KVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHG 867
            :.||..|::..         ||..|::                                      
Mouse   828 EWPLLPRRETR---------REAALTL-------------------------------------- 845

  Fly   868 EEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLS 932
              |::.|               .|.||.::| .||..:                      :..|.
Mouse   846 --DDKGD---------------LFAKKYKLI-REDGCK----------------------IHNLV 870

  Fly   933 QEERALFR------EYEIYV---DEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQE 988
            :|.|.|||      .::|||   |:|:.|....:::....:.....:.:.: .||.|:..|.|..
Mouse   871 EENRKLFRADPSLDSWKIYVEFIDDIVVEGFFQAILHDLDFFLRNTEKQLK-PTPFFQAQMLLMP 934

  Fly   989 PNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDK 1053
            |.:|:...|:..:..||...:|.:|.....:.:.:.|||      .:::...:.:::.:...|.:
Mouse   935 PEIVFKPPLEKEAGDGFYDLVEEMLCGSFRVSAQMGRVA------AHLDIADYQNDMDNMLGLAE 993

  Fly  1054 QRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGV 1118
            .|.||||::...:..|.........:|.||:.|:...|.:...:|..:..:|.||.|    |..:
Mouse   994 VRQEIMNRVADVINKVLEFRSSLETYSYLWVDDRVEILRQFLLYGHAVPSEEMDAPA----SEDI 1054

  Fly  1119 KLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLD 1183
                |:.|.|..:|||:|.:..|..|:..::.:..|..:.:::|..||:::|:.:.:|..:|:..
Mouse  1055 ----LQPPTLEQFKEQIDIYEALYIQMSKFDDFRVFNSWFKVDMRPFKLSLLNVIKKWSWMFQEH 1115

  Fly  1184 LINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDL 1248
            |:..|.:||.|||.|:.:.|..|:.:|.:.|.:|||.|:..|..:..:|...|.:|:||||.|.|
Mouse  1116 LLRFVVDSLSELQGFIKQTNAGLQRQLCEGDHDGLVDIMGHLLAVRSRQRATDELFEPLKETIML 1180

  Fly  1249 LRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKK 1313
            |..|..:..:...||:.|||:.|...|::||..:..::|:|:.:|.||.|:.:|.|.....:|::
Mouse  1181 LESYGQKMPEQVYAQLEELPERWETTKKIAAMVRHEVSPLQNAEVTLIRKKCILFDEKQAEFRER 1245

  Fly  1314 FLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIM 1378
            |.|.........:.|.::|:::.||.||||....:..||.|||:..|:..:::.||.:::|:|.:
Mouse  1246 FRSYAPLGFKAENPYAVLDKANQELEALEEEMEQMQNSARLFEVALPEYKQMKQCRQEIRLLKGL 1310

  Fly  1379 WDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSL 1443
            ||..|.::.:|::|.:|.|::|::|.||.|.::|.:|:..||||:|.|:.:..:|.::|::.|||
Mouse  1311 WDVIIYVRRSIDNWTETQWRQINVEQMDLELRRFAKEIWSLDKAVRVWDAYSGLEGTVKDMTTSL 1375

  Fly  1444 RAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEK 1508
            ||:.||||||:|||||.:||:...|:||::|||||.||:.:.||..|::|::|||::|||:..||
Mouse  1376 RAIAELQNPALRDRHWQQLMKAIGVRFSINDSTTLSDLLAVQLHRVEDDVRDIVDQAVKELGTEK 1440

  Fly  1509 QLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQN 1573
            .:.|::..|..:||..:.|.||...|||:.|:|.||||.:|.|||::..|||:.:|..:|..|||
Mouse  1441 VITDVSHTWEALEFSYEAHHRTGTPLLKSDEQLFETLEHNQVQLQSLLQSKYVEYFIEQVLSWQN 1505

  Fly  1574 RLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVR 1638
            :|:.||.:|.:|.:|||.|.:|||||:.|||||.||.||:||||.:|.|||.|:.:....:||:.
Mouse  1506 KLNVADAVIFTWMQVQRTWSHLESIFVCSEDIRVQLVEDARRFDKVDAEFKELMFETAKVKNVLE 1570

  Fly  1639 STNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARH 1703
            :|.|  ..|||.|:.....|.||||||.:||||||:::|||||:||||||||||.|..|..|..|
Mouse  1571 ATCR--PHLYEKLKDFQHRLSLCEKALAEYLETKRVTFPRFYFISSADLLDILSKGAQPKQVTHH 1633

  Fly  1704 LTKLYDSMGKL----NLISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRD 1764
            |.||:||:..|    ||...:..|.||.:|| :|||||...|:|.|.||.||.::...|:||:|.
Mouse  1634 LVKLFDSISDLQFEDNLDVSTHKAVGMFSKE-KEYVPFQAGCECIGHVESWLLQLEQTMKDTVRL 1697

  Fly  1765 QLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLN 1829
            .:..::|.|:.|||.:|||::|||.||.|:||.|||:...||:::::.||.||||::||||:|||
Mouse  1698 AITEAITAYEEKPRELWIFDFPAQVALTGSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLN 1762

  Fly  1830 NLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFA 1894
            .||.||||:|:..:|||:|||||||||:||||..:|::||....||.|.|||||.|:.....|..
Mouse  1763 TLITLLLGELSPGDRQKVMTICTIDVHARDVVAKLISQKVVSPHAFTWLSQLRHEWEDSRKHCVV 1827

  Fly  1895 NICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALG 1959
            |||||.|:|.||||||:||||||||||||||||||||||.|.|||||||||||||||||||||||
Mouse  1828 NICDAHFQYFYEYLGNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALG 1892

  Fly  1960 MMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTF 2024
            ||||||||||||||:|||:|:|||.||||||||||||||:||||||||||||.|.|||::.::.|
Mouse  1893 MMVYVFNCSEQMDYRSIGNIYKGLVQTGAWGCFDEFNRIAVEVLSVVAVQVKMIHDAIRNGRKRF 1957

  Fly  2025 SFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARL 2089
            .||||.|.|:.:||:|||:|||||||.|||||||||:||||||.||..||.|||||||||.:||.
Mouse  1958 VFLGETIPLKPSVGIFITLNPGYAGRTELPENLKALFRPCAMVAPDTELICEIMLVAEGFVDARS 2022

  Fly  2090 LARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIV 2154
            ||||||:|||||:||||||||||||||||||||||||:|:|.|:.|||||||||||||||:||||
Mouse  2023 LARKFISLYTLCEELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDFNMPKIV 2087

  Fly  2155 TDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVF 2219
            |||||||:||:.||||||||||:|.|.||.::|:|.|:|:||||:.||||:||||||.|||||||
Mouse  2088 TDDVPVFLGLVSDLFPALDVPRQRKPHFEQMVKQSTLELRLQPEESFILKVVQLEELLAVRHSVF 2152

  Fly  2220 IIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQ 2284
            ::|.||||||::.:|||:||.|.|:||.::||||||||.|||||.::.:||||||||||.::|:|
Mouse  2153 VVGNAGTGKSKILRTLNRTYVNMKQKPVWSDLNPKAVTTDELFGFIHHATREWKDGLFSSILREQ 2217

  Fly  2285 ANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPAT 2349
            |||...||.||||||||||:||||||||||||||||||||||:||...||||||...||||||||
Mouse  2218 ANLTHDGPTWIVLDGDIDPLWIESLNTVMDDNKVLTLASNERVALKPSMRLLFETHHLRTATPAT 2282

  Fly  2350 VSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIA 2414
            ||||||||:|||||||.|::.||:..|.:.||.:.|.:|||||:|..|:..||..::||.:.:.:
Mouse  2283 VSRAGILYVNPQDLGWNPYVASWIDRRRHQSEKANLTILFDKYIPVCLEKLRTSFKAITSVPESS 2347

  Fly  2415 RLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKA 2479
            .:|..|.||:.:|||:|:|.|.||:.||:||.|..||.||.:|.:||:.|:..:||:|:..|.||
Mouse  2348 LVQTICTLLECLLTPENIPPDSPKETYEVYFAFACVWTFGGTLLRDQLSDYQADFSRWWHKEMKA 2412

  Fly  2480 VKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHP 2544
            ||||..||||.:|:||:||||.|||:.||||.:|.|.||::.||:|.||||||:|.:.|:....|
Mouse  2413 VKFPSQGTIFDYYLDHKTKKFLPWTDKVPQFSMDADAPLKTVLVHTPETTRLRYFTELLLCKGKP 2477

  Fly  2545 LMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNK 2609
            :||:|.:|.|||:.::..|::| |:.|.|:.||||:||||..|||||||||||||||||||.|||
Mouse  2478 IMLVGNAGVGKTVFLSNTLASL-SENYIVSCVPFNYYTTSAALQRILEKPLEKKAGRNYGPKGNK 2541

  Fly  2610 RMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTID 2674
            :::||:||:||||||.|.|:|||.|:||.:||.|||||.|:.|::|..|..||||||..||||::
Mouse  2542 KLVYFIDDLNMPEVDLYGTIQPHALLRQHIDYGHWYDRHKIMLKEIRNCQYVACMNPMVGSFTVN 2606

  Fly  2675 PRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSF 2739
            |||||||..||.|.||.|||..|...|.|.::..  |.|..:|::...:::...|..|..:..||
Mouse  2607 PRLQRHFTVFAFNFPSLDALTTIYGQIFSFYLQQ--QAFCPSVLRAGPSLIQATIAFHQMMAESF 2669

  Fly  2740 LPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKI 2804
            :||||||||||||||::|||.|:|:::.|...:...:.|||:||..|||||:|:|..|.:.|::.
Mouse  2670 VPTAIKFHYNFNLRDLSNIFQGILFASPECLKSLEDLARLWLHETSRVYGDRLIDTNDFDLFQRK 2734

  Fly  2805 VSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNL 2869
            :.:...|..:||:.:.:..|||:|||||.|..|..|||:..|:.||::|.|..|.||:...||:|
Mouse  2735 MLETAHKYFKGVDANALLRQPLVYCHFASGGEDPCYMPVKDWEGLKAVLMEMVDNYNELHSAMHL 2799

  Fly  2870 VLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKA 2934
            |||:|||.|||||||||...:|:||||||||||||||:|||::|.||:||||.||:.|...:|:.
Mouse  2800 VLFEDAMQHVCRISRILRIPQGHALLIGVGGSGKQSLSRLAAYICSLEVFQITLTEGYGAQELRV 2864

  Fly  2935 NIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQ 2999
            ::|.||::.|.|.....||:||:.|..|.||||:|||||||||.:||.|::::.|::.:||||:.
Mouse  2865 DLANLYVRTGAKNMPTVFLLTDAHVLDESFLVLINDLLASGDIPDLFSDEDMDKIISGIRNEVRG 2929

  Fly  3000 LGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESV 3064
            ||:||:|||||.:|:.:||..||:|.||||||.|||||:|||||:||||.|||||||||:||.||
Mouse  2930 LGLVDSRENCWAFFLARVRQQLKMVFCFSPVGHTLRVRARKFPAIVNCTAIDWFHEWPQEALVSV 2994

  Fly  3065 SLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHE 3129
            |.||:.||..:..:....:|.|||.||.:|.::|..|..|.:|||||||:||||.|:|:..||.:
Mouse  2995 SRRFIEEIEGIEPQHKDSISLFMAHVHTSVKEVSAWYYQNERRYNYTTPRSFLEQISLFKSLLKK 3059

  Fly  3130 KVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKER 3194
            |.:....::..|.||:.||.:...:|..|:..|..||.||:::|.:|:.||..:|.:.||||:|:
Mouse  3060 KREEVKQKQEHLGNGIQKLQTTASQVGNLKSRLASQEAELQLRNLDAEALITKIGLQTEKVSREK 3124

  Fly  3195 AFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVS 3259
            |.|..||:.|..|:.:.:.|.:.||.|.|||:|||:||::||||||:.||||||:|.:||:||.:
Mouse  3125 AIADAEERKVAAIQTEASQKQRECEADLLKAEPALVAAKDALNTLNRVNLTELKTFPNPPNAVTN 3189

  Fly  3260 VCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKAL-QPYILDAEFS 3323
            |..||:||.:.:|::||||||||.:.|||.||.||..||||||:||..:.:|.: :.|:.|.||:
Mouse  3190 VTAAVMVLLAPRGRVPKDRSWKAAKIFMGKVDDFLQALINYDKEHIPENCLKVVNEQYLKDPEFN 3254

  Fly  3324 PEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQ 3388
            |..|..||.||||||:|||||.|||:||..||||.:||.::..::..|.:||.|:..:|.:|:..
Mouse  3255 PNLIRTKSFAAAGLCAWVINIIRFYEVYCDVEPKRQALAQTNLDLAAATEKLEAVRRKLVDLDHN 3319

  Fly  3389 LNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDIL 3453
            |:.|...:::|.|:|.:||:|.::|..|||:||:|:..|.:|||||.:|:|......:.|.||:|
Mouse  3320 LSRLTASFEKATAEKVRCQEEVNQTNKTIDLANKLVSELESEKIRWGQSIKSFETQEKTLCGDVL 3384

  Fly  3454 IISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSD 3518
            :.:.|:||:|.|||.|||||.:..|:| |...:..||..:|:|...|:.|||.||.|||:|||||
Mouse  3385 LTAAFVSYIGSFTRQYRQELVDCKWIP-FLQQKVSIPIAEGLDLIAMLTDDATIATWNNEGLPSD 3448

  Fly  3519 RMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIE 3583
            |||.|||.||...||:|||||||.|||||:|.|||..|.|..|.|:.:|:.:|.|::.|.|:|||
Mouse  3449 RMSTENATILTHCERWPLMIDPQQQGIKWIKNKYGPDLKVTHLGQKGFLNTIETALAFGDVILIE 3513

  Fly  3584 NIGENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFT 3648
            |:.|.:||||.|||||...|||..::|||:|.:||..|||||||||||||||||:||||||:|||
Mouse  3514 NLKETVDPVLGPLLGRNTTKKGKFIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQTTLLNFT 3578

  Fly  3649 VTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLV 3713
            ||.||||.|||||||.:||||||.::..||:|||.|||.|:.||||||.|||:|..:.|:|..||
Mouse  3579 VTEDGLEGQLLAEVVSIERPDLERLKLVLTKQQNDFKIELRQLEDDLLLRLSAAEGSFLDDTDLV 3643

  Fly  3714 MNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAF 3778
            ..||.||.||.|||.||.||:....:|:..||.|||.|.|||::||:::||.:|||:||||||||
Mouse  3644 ERLETTKATAAEIEHKVTEARENERKINETRECYRPVAARASLLYFVISDLRRINPVYQFSLKAF 3708

  Fly  3779 TVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEP 3843
            ..:|:.|:.:|...|..::|:..||:|||..:|:|.|:.|||:|||.||:|:..|||:...|:.|
Mouse  3709 NTLFHRAIEQADKVEDTQERICALIESITHATFLYASQALFERDKLTFLSQMAFQILLRRNEIHP 3773

  Fly  3844 TELDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENE 3908
            .||||||||......:|...:||...|..::|:.....|:||::|:|||.|:|:|:|:||.||.|
Mouse  3774 LELDFLLRFTVEHTYSSPVDFLTAQSWSAVKAVALMEEFRGLDRDVEGSAKQWRKWVESECPEKE 3838

  Fly  3909 KFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFF 3973
            |.|.|||.||.||:|.|:|.:|||||:||:|:|:|||||:||::...::..:.||||||.|.:||
Mouse  3839 KLPQEWKKKSLIQKLIILRAVRPDRMTYALRNFVEEKLGAKYVERTRLDLGKAFEESSPSTPVFF 3903

  Fly  3974 VLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVAR 4038
            :||||||.|||:|.|||.|||:.|...||:||||||||:|||.|:|.|:..||||||||:||||:
Mouse  3904 ILSPGVDALKDLEVLGKRLGFTIDSGKFHNVSLGQGQELVAEMAMEKAAAGGHWVILQNVHLVAK 3968

  Fly  4039 WLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAH--ILPQGILESAIKITNEPPTGMMANIHKA 4101
            ||.:|||.:|......|..||:|||||..  |:.|  |:|||:||::|||||||||||:||:|.|
Mouse  3969 WLGTLEKLLEKFSQGSHRDYRVFLSAETV--PSQHEPIIPQGLLENSIKITNEPPTGMLANLHAA 4031

  Fly  4102 LDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL 4166
            |.||..:|||||||:.|||:||||||||||.||.|.:||||||:|||||:.|||||...:|||||
Mouse  4032 LYNFDQDTLEMCSKDQEFKSILFSLCYFHACVAGRLRFGPQGWSRSYPFSPGDLTICTNILYNYL 4096

  Fly  4167 EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYT 4231
            |||..|||||||||||||||||||||.|||:|||.||||||.|.||:.|:....||.||....|:
Mouse  4097 EANPNVPWEDLRYLFGEIMYGGHITDAWDRKLCRVYLEEFMNPSLIEDEVMLAPGFAAPPYSDYS 4161

  Fly  4232 GYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDI--- 4293
            |||.||:|.||.|||:|||||.||||..||..|..|||.:.|:|||        ..||||::   
Mouse  4162 GYHQYIEDTLPPESPALYGLHPNAEIELLTVTSNTLFRTLLEMQPR--------NAVSQEELGQS 4218

  Fly  4294 ----IKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLK 4354
                :|||::|||::.|..||:.|:|.:..:||||::|.||||||||.|:.|::.||..||||||
Mouse  4219 TEDKVKNILDDILERLPEEFNMAEIMQKNPNRSPYVLVCFQECERMNVLIREIRVSLQHLDLGLK 4283

  Fly  4355 GELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWL 4419
            ||||:|..:|..:..|..|:||:.|.||||||..||..||:||:||.|||:.|..|..:|:.:||
Mouse  4284 GELTLSPDVETQLSALSYDRVPDTWNKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWL 4348

  Fly  4420 AGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMK 4484
            :|||||||.||||||..|||||||||||||..|||||.||:....||||||::||.:||||||::
Mouse  4349 SGFFNPQSFLTAIMQTMARKNEWPLDRMCLTIDVTKKTKEDYGHPPREGAYLHGLHLEGARWDIQ 4413

  Fly  4485 MGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERASKWT 4549
            .|.:.||.||||...|||::.|||..|:|:||:.|||||||.:.||||:||||.|:|::|.:||.
Mouse  4414 SGALVDARLKELTSMMPVIFAKAVPVDRQEIKHAYECPVYKTKARGPTYVWTFRLRSKDRIAKWV 4478

  Fly  4550 LAGVCLLLQ 4558
            ||||.|||:
Mouse  4479 LAGVALLLE 4487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 142/601 (24%)
DHC_N2 1368..1770 CDD:285579 195/406 (48%)
P-loop_NTPase 1903..2132 CDD:304359 190/229 (83%)
P-loop_NTPase 2217..2352 CDD:304359 99/135 (73%)
P-loop_NTPase 2510..2783 CDD:304359 147/273 (54%)
P-loop_NTPase 2860..3127 CDD:304359 158/267 (59%)
MT 3140..3480 CDD:289543 163/341 (48%)
AAA_9 3509..3722 CDD:289547 138/213 (65%)
Dynein_heavy 3864..4549 CDD:281078 416/694 (60%)
Dnah11NP_034190.3 DHC_N1 220..790 CDD:285571 142/603 (24%)
DHC_N2 1300..1703 CDD:285579 195/406 (48%)
P-loop_NTPase 1836..2065 CDD:304359 190/229 (83%)
P-loop_NTPase 2150..2285 CDD:304359 99/135 (73%)
P-loop_NTPase 2443..2713 CDD:304359 147/273 (54%)
P-loop_NTPase 2790..3057 CDD:304359 158/267 (59%)
MT 3069..3413 CDD:289543 165/345 (48%)
AAA_9 3439..3652 CDD:289547 138/213 (65%)
Dynein_heavy 3792..4478 CDD:281078 416/696 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.