DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and DNAH14

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001354408.1 Gene:DNAH14 HGNCID:2945 Length:4617 Species:Homo sapiens

Alignment Length:4836 Identity:1256/4837 (26%)
Similarity:2126/4837 (44%) Gaps:910/4837 (19%)


  Fly   408 TFNSQDWTWHQDEIFGRLDK-------FLVRLEELKDLFNTVR--DFQKLEKIVMGGLKGRQITF 463
            ||...|.|....|    :||       .|:|.||.|  :..|:  :.|..|......|:.:.:..
Human     3 TFIPIDLTTENQE----MDKEETKTKPRLLRYEEKK--YEDVKPLETQPAEIAEKETLEYKTVRT 61

  Fly   464 ALEKILEEYNSIYREWTNIQYNPIDPD----AENSLFQR-------------------DRLSFKA 505
            ..|.:..|....|...:.||.:.:.|:    .|....:|                   ||...| 
Human    62 FSESLKSEKTEDYLRESIIQQHMVSPEPASLKEKGKSRRKKDQTHACPNVRKARPVSYDRTEPK- 125

  Fly   506 KTDVMERMVSFQFEKGLE---DTHDLLLAGS-LLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEF 566
            ..||:..::..:.:.|.:   ..|.|....| :.::.|..|  :||     :|..|.:.|:.:: 
Human   126 DDDVIRNIIRLREKLGWQTILPQHSLKYGSSKIAIQKITLK--KPL-----EDDGEFVYCLPRK- 182

  Fly   567 INFKNVFTALGLNELPTDDC-----FPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGY 626
             :.|:::....|..:.....     |..::.  ||:.|:.: |:|..||.||.....:.:||..|
Human   183 -SPKSLYNPYDLQVVSAHTAKHCKEFWVITA--SFISKVIN-IVGSVKEVELIPTLEWLSERRHY 243

  Fly   627 VSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDI-- 689
                  .::::...|:...::|..| .|:     :.:..|:.:::.    :|....:|...|:  
Human   244 ------YLLRQFKIFSDFRMNKAFV-TWK-----LNVKRIKTEKSR----SFLYHHLFLADDLFQ 292

  Fly   690 -KVVRLLG-CDVSVNLTKF-------------------------FCREDELWQARVKLMRIAEWY 727
             .:|.:.| |:.::||..:                         || |::|.||...|.::.:..
Human   293 TCLVYIRGLCEDAINLKNYNDHENNLSAICLVKLDSSRTYSLDEFC-EEQLQQATQALKQLEDIR 356

  Fly   728 NDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFS----QRFIVMIFK---MVKYLHDRLV 785
            |........|  .|..||...|:|..:..|.......|.    :|.:...||   :|.|:...|:
Human   357 NKAISEMKST--FLKVAEKNEIKEYFESKLSEDDTTHFKLPKYRRLLETFFKFVMLVDYIFQELI 419

  Fly   786 AAQEN--LEAIKESIRSWGKVPL-FQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYV 847
            ....|  :..:.|.......:|. .::|:.|   |:.|.......:.:..|  |.:.|:|     
Human   420 RQLMNTAVTLLLELFNGSAGMPFSVEKKNEN---LIRTFKDNSFPTGKTTN--DCEELVD----- 474

  Fly   848 NLKLF----------FDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSV-----KFKKKREV 897
            |.||.          .|......|...|.|::..::   :.||..:::...:     ..:..:|.
Human   475 NSKLHAISVQKSEVKTDTDINEILNSVEVGKDLRKT---YAPIFEVNLCLRIPAESDSSENSKEN 536

  Fly   898 IDEEDDLEE----FEEEQSESEEEIITPFHRYELL-KGLSQEERALFREYEIYVDEIIAENLVDS 957
            ..|.|...|    ||:|.||:::..:......||| |....:|              |:.||.| 
Human   537 FHESDQCPEECVMFEDEMSENKDNCVKKHSSEELLPKAKKSKE--------------ISYNLED- 586

  Fly   958 VITSSTYLRMEVDNRYENNTPIFEIFMELQE-PNVVYFRNLDTSSKTGFAFFIETILDDMNNMMS 1021
             |.|.|.:..|.:|:|        ::.|..| |..::.    ..::..|:..|:.:|.:|...::
Human   587 -IISDTEIETEFENKY--------MYYEFPEFPTNLFI----DPNRLEFSVKIQNMLTNMEKCIT 638

  Fly  1022 LLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWD 1086
            .:..:.|||       ..|.:.:|....:|..:...|::                  :.....|.
Human   639 TITPLCQDP-------QLSIFIDLVSIMDLPNKTGSIIH------------------YKEQTRWP 678

  Fly  1087 KSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWE-- 1149
            ....|.|.....:|:.::.            :.::|.....::.|..:..|:..:.::.:...  
Human   679 DCHILFETDPAYQNIIVNL------------LTIIGNSMGLVNAYSHKFIKYCTMTEKAKIMSMK 731

  Fly  1150 -------TYEDFFVFLRLNMTGFKVAVLSQVGQWISLFK-------------LDLINRVKNSLKE 1194
                   |.::|...|......|:..|...:.:.|.:|.             :|.:..:.::|  
Human   732 ISSMGELTSKEFEAILNRFRNYFRHIVNMAIEKRIGIFNVVSLDYQSECLLYIDNVIHMSHTL-- 794

  Fly  1195 LQDFVDEANIVL---------KIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLR 1250
            :|..:::.|..|         ::|....:.|..::....||.|:.|....:..|..:.::..:.:
Human   795 IQSVIEKKNKNLLEVVESSLQQLECDPTEIEEFLEHFIFLNAISSKISKLEKEFLTMSQLYSVAK 859

  Fly  1251 QYNYEFKDTELA-------QINELPDAWMKVKRL---AATTK---QLIAPIQSYQVDL------I 1296
            .:.....:.::|       :.::|..: ||:.::   .|.||   .|.|.|....||:      |
Human   860 HHQIHISEEQIAIFQVLLLKFSQLKSS-MKLSKINKDTAITKFRDNLEACISGLHVDVGNLKAKI 923

  Fly  1297 EKRILLC----------------------DNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELV 1339
            ...:|||                      .|.|..|.        .:..|.|    ..:|.:..|
Human   924 RTPLLLCAGTQVSTAMEMIQTLSGEAASLTNKAKAYS--------HYQDCFS----DSQSHMHSV 976

  Fly  1340 ALEE-RQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPW------ 1397
            .:|| .|..|:|   :.:::|           ||.|.|.:|:       ...:||:..|      
Human   977 NVEEITQIVLSE---ISDIEG-----------DLTLRKKLWE-------AQEEWKRASWEWRNSS 1020

  Fly  1398 -KKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMT----SLRAVTELQNPAIRDR 1457
             :.||:|::.:...|....:..|:|.:    |...|...||.::|    .|..:..|.||.::.|
Human  1021 LQSIDVESVQRNVSKLMHIISVLEKGL----PKSDMVTHLKQVVTEFKQELPIIIALGNPCLKPR 1081

  Fly  1458 HWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEF 1522
            ||..|.:.......:|.:..:::|:.|.:.:||.|:.::...:..|.|:||.|..|...|.|...
Human  1082 HWEALQEIIGKSVPLDKNCKVENLLALKMFQYENEINDMSTSATNEAALEKMLFKIIDFWNTTPL 1146

  Fly  1523 GTDIH--DRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSW 1585
            ...:|  :..||.::.:.:::...||:.|..|..:..|.:|...:..|..|...|:.....:..|
Human  1147 PLILHHTEIYSIFIIPSIDDISAQLEESQVILATIKGSPHIGPIKDLVNEWDQNLTLFSYTLEEW 1211

  Fly  1586 FEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEH 1650
            ...||.|.|||.:|..|| ||.|||.::..|..:...:|.:::::...:|.::.|..:|      
Human  1212 MNCQRNWLYLEPVFHSSE-IRRQLPAETELFSQVISMWKKIMSKIQNKQNALQITTSAG------ 1269

  Fly  1651 LEILLKMLLLC-------EKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLY 1708
               :|::|..|       :|:|.||||.|||.:|||||:|:|:|||||::..||..|..||.|.:
Human  1270 ---VLEILQNCNIHLEHIKKSLEDYLEVKRLIFPRFYFLSNAELLDILADSRNPESVQPHLVKCF 1331

  Fly  1709 DSMGKLNLIS---GSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSL 1770
            :::.:|.:..   |......:::.|.|..| ..:.......||.||..:...|.|.|:..|.:.:
Human  1332 ENIKQLLIWKQDIGPPAVKMLISAEGEGLV-LPKKIRVRSAVEQWLVNVEKSMFDVLKKFLSQGI 1395

  Fly  1771 TFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILL 1835
            ..::.:....|:...|.|..|..:|||:..:...:|.....|  ..|:..:...:..|..:..|:
Human  1396 EDWNCQMFSQWVLSHPGQVVLTVSQIMFYNDCVKSFVSSYSR--EKLEKVHAGLMCHLEEVADLV 1458

  Fly  1836 LGDLTAAERQKIM-TICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDA 1899
            :.|.:.:..:.|: .:..:.||.||:|..::.|.:.....|:|...|:::|:.|...|:.:..:|
Human  1459 VLDTSNSRTKAILGALLILYVHCRDIVINLLLKNIFNAEDFEWTRHLQYKWNEKQKLCYVSQGNA 1523

  Fly  1900 QFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYV 1964
            .|.|.|||||.|.|||||||||||::||.::|||.:||.||||||||||||.|||.::||....|
Human  1524 SFTYGYEYLGCTSRLVITPLTDRCWLTLMEALHLNLGGCPAGPAGTGKTETVKDLAKSLGKHCVV 1588

  Fly  1965 FNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGE 2029
            |||.|.:|||.:.....||.|:|||.||||||.|.:|||||:|.|:..|:.|..:....|...|:
Human  1589 FNCFEDLDYKIVRKFFFGLVQSGAWSCFDEFNLIDLEVLSVIASQILTIKAAKDNYSARFVLEGK 1653

  Fly  2030 HIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKF 2094
            .|.:..:..|||||||.|.|..|||:|||:|:||.||:||.:.:|:||:|.:.||:.|..|:.|.
Human  1654 EIRINMSCAVFITMNPRYGGGVELPDNLKSLFRPVAMMVPHYQMIAEIILFSFGFKSANSLSGKL 1718

  Fly  2095 ITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDR--------QRPEDQVLMRALRDFNIP 2151
            ..||.|.::.||:||||::|||::|.||::||..:|:.:        :..|..:::.|:|:.::|
Human  1719 TNLYELARKQLSQQDHYNFGLRSLKIVLIMAGTKKREFKCDTSDSLSEADETLIVIEAIREASLP 1783

  Fly  2152 KIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRH 2216
            |...:|||:|..:|||:||.:.|.:......|.||..:...|.||.......||:|......|..
Human  1784 KCPPEDVPLFENIIGDIFPEVTVLKVNQLALEKVIYTATQQLGLQNWSSQKEKIIQFYNQLQVCV 1848

  Fly  2217 SVFIIGFAGTGKSEVWKTLNKT--------------------YQNQKRKPHYNDLNPKAVTNDEL 2261
            .|.::|..|.||:.|.:.|.|.                    ...:|.|.....||||.||..||
Human  1849 GVMLVGPTGGGKTTVRRILEKALTLLPIADFLSVAERKSASKISERKGKVDICVLNPKCVTLSEL 1913

  Fly  2262 FGIVNPSTREWKDGLFSILMR--------------------------------DQANLGGTGP-- 2292
            :|.::|:|.||.|||.|..:|                                |.::...|..  
Human  1914 YGQLDPNTMEWTDGLLSATIRSYVYFNTPKNTKKDIDLRLKSRISDLSNVFKLDSSDTTETDDNI 1978

  Fly  2293 ------------------KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEI 2339
                              :||:|||.:|..|:|:||:|:||.:.|.||::||||||.::|::||:
Human  1979 FEEIEKVVKIPENHNFDWQWIILDGPVDTFWVENLNSVLDDTRTLCLANSERIALTNKIRVIFEV 2043

  Fly  2340 ASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRT----NSSEVSMLNVLFDKYVPPLLDIF 2400
            .:|..|:||||||..::|::|.||||.|:::||| .:|    :.|.|..|..:....|...|...
Human  2044 DNLSQASPATVSRCAMVYMDPVDLGWEPYVKSWL-LKTSKIISQSGVDCLEFMIKNSVTDGLQFI 2107

  Fly  2401 RTRLR-SITPISDIARLQMTCYLLDSM------------------------------LTPQNVPN 2434
            |.|.: ...|:.||..:...|.:||:.                              :|.:::..
Human  2108 RNRQKFQPYPMEDITVVITLCRILDAFFDFMGKNGGFEQSDDLNDTSSKEANSQRESVTFKDIEK 2172

  Fly  2435 DCPKDWY------------EIYFVFCIVWGFGS----------------SLFQDQIIDWSNEFSK 2471
            .....||            :..|||...|.||.                ||..|.:...:.:|.|
Human  2173 RDENTWYPEKNPDKLTKIIQKLFVFAFTWAFGGALNREDEHRENIPFCPSLEPDSLAKVTYDFDK 2237

  Fly  2472 ----WFLNEYK-AVKFPLSG-TIFSFYIDHETKKFFPWTNLVP--QFELDMDLPLQSNL------ 2522
                .|.|..: .:..|... :||.:::|.|..:|.||::|||  |..:.....|.:||      
Human  2238 LVHELFGNSSQVGINLPTGECSIFGYFVDIEQCEFIPWSDLVPNDQTLIQRGTSLLTNLQRSGGN 2302

  Fly  2523 ----------VN---TAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSAL-------- 2566
                      :|   |.:||.|.|.|..|::...|::|.|.||.|||..:|..|..|        
Human  2303 FLKITECGECINYTATRDTTCLSFLMSLLLKNSCPVLLTGESGVGKTAAINQMLEKLEGPGAFDI 2367

  Fly  2567 ------------------------------------------PSDKYSV-TN------------- 2575
                                                      |:.|..| ||             
Human  2368 KHGSILGDTLLYSEIKKSSSLKQNITILIPETHKTATGSSDNPTKKPEVRTNKKLLKNNDHKGVV 2432

  Fly  2576 ---VPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQ 2637
               :.|:...|:...:.::.|.|.::.....|...|.|::.|:||||||..|.|....|..||||
Human  2433 VSTINFSTNVTAAKTKEMILKKLIRRTKDTLGAPKNNRILIFIDDMNMPVSDMYGAQPPLELIRQ 2497

  Fly  2638 FMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSIL 2702
            .:|....||.:|.|.::|...:|||...|....  |.|||.:||....:..||||.|..|..:.|
Human  2498 LLDLGGVYDTEKNTWKNIQDLSIVAACVPVVND--ISPRLLKHFSMLVLPHPSQDILCTIFQAHL 2560

  Fly  2703 SQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNS 2767
            ..:..  |..|...|.|..:.:::.::.::.:|..:.|||..|.||.|||||:..:..|:|.:: 
Human  2561 GIYFS--INNFTPEVQKSKDQIISCSLAIYHQVRQNMLPTPTKCHYMFNLRDMFKLLLGLLQAD- 2622

  Fly  2768 ETCPNSNQMIR-LWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHF 2831
            .|..||.:|.. |::||..||:.|:|:|:||.:.|.:::|..:....:     :.:.|..:..|.
Human  2623 RTVVNSKEMAALLFVHEATRVFHDRLIDFTDKSLFYRLLSRELENCFQ-----IQWTQENLMNHS 2682

  Fly  2832 AKGL--TDIK-------YMPISGWDRLKSLLDEAQDRYNDYIGAMNL------VLFDDAMSHVCR 2881
            ...|  .||.       |...|.:::|.|:|||.|.:    :|:::|      |.|.:|:.|:.|
Human  2683 TVFLDFLDINKTHRKKIYQNTSDYNKLASVLDEFQMK----LGSISLELSHSMVFFKEAIEHIIR 2743

  Fly  2882 ISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVK 2946
            .:|:|.....:.||||:.|.||::...||.:::...::::.::...:..:.|.....:::.||:|
Human  2744 ATRVLRQPGSHMLLIGIDGCGKKTCATLACYLTDNKLYRVPISHKCAYIEFKEVFKKVFIHAGLK 2808

  Fly  2947 TSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWK 3011
            ......::.:..:.::.||..:|.:::||.|.:||.:.|:::|...:|...:|.|.:|||::...
Human  2809 GKPTVLMVPNLNIEQDSFLEDLNYIISSGRIPDLFENVELDSIAMKIRYLTEQSGHMDNRQSLLS 2873

  Fly  3012 YFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLP 3076
            :|.:::...|.:.:..||.|.:.|...|.:|::::..||||:..||::||..|:..||.|.....
Human  2874 FFQKRIYKNLHIFVIMSPEGPSFRQNCRVYPSMISSCTIDWYERWPEEALLIVANSFLKEKVNFE 2938

  Fly  3077 -----KELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLD 3136
                 ||...|.   ...:||::.|:::.|.....|:.||||.|:|:.:..::.:|..:.:....
Human  2939 NRENLKEKLAPT---CVQIHKSMKDLNRKYFEETGRFYYTTPNSYLQFMETFAHILRAREEEMQT 3000

  Fly  3137 RRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEE 3201
            :|.|...||..:...|..|..:|:.|.:...:::.|.:|.:.|:       ||:.|:.....|.:
Human  3001 KRDRFHMGLSTILEATTLVTEMQEELLILGPQVEQKTKETETLM-------EKLRKDSQVVEKVQ 3058

  Fly  3202 KNVRQIEEDVTAKAKLCEE-------DFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVS 3259
            ..|:|.||.|..:.::.|:       :.....||...|..|||.|:|.::.||:.:..||..|::
Human  3059 MLVKQDEEIVAEEVRIVEDYAQKTANELKSVLPAFDKAIVALNALDKADVAELRVYTRPPFLVLT 3123

  Fly  3260 VCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSP 3324
            |..||.:|      :.|..:|...:..:.... ||..|||.||..|...|...|:..:...:|:|
Human  3124 VMNAVCIL------LQKKPNWATAKLLLSETG-FLKKLINLDKDSIPDKVFVKLKKIVTLPDFNP 3181

  Fly  3325 EKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQL 3389
            .||...|.|...||.|||.:|.:::|..||.||:..:.|::..:|.||.:|......|..:||.|
Human  3182 HKISLVSVACCSLCQWVIALNNYHEVQKVVGPKQIQVAEAQNVLKIARQRLAEKQRGLQLVEEHL 3246

  Fly  3390 NALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILI 3454
            ..||..|.:.:|:||...:..:..:.....|:.|:..|..||.||.|::..:...::.:.||||:
Human  3247 LFLQAAYKDTVAEKQLLANRKTMASRRFQCASVLLTVLEDEKTRWQETINQIDNKLEGILGDILL 3311

  Fly  3455 ISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDR 3519
            .:..|.|.|..|..:||.:..|......:|.   |..:......:::....:|:.|:|||||..:
Human  3312 SAACIVYSGILTPEFRQLIVNKWETFCIENG---ISLSSKFSLIKVMAQKYEISRWHNQGLPHGQ 3373

  Fly  3520 MSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIEN 3584
            .|.|||.::...:::||:|||..|..||::...|:.|..|.:...||..::|.|:..|..:|::|
Human  3374 YSVENAILIKNGQQWPLLIDPHRQAHKWIRQMEGSRLQKLSIEDSNYTKKIENAMKTGGSVLLQN 3438

  Fly  3585 IGENIDPVLNPLLGRQLI-KKG-TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINF 3647
            :.|.:.|.|..:|.:.:. ||| ..:::||.|.::||.|||.|.|::.|||:.|.:....|:|||
Human  3439 LLETLAPGLKAILKKDIYQKKGHYFIRVGDAEFEYNSNFRLYLSTEIDNPHFLPSVYNFVTMINF 3503

  Fly  3648 TVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTL 3712
            |||..||:||||:.||..|.|.||..|::|.:..:...|||:.||:..|..|..|..::|:|..:
Human  3504 TVTFQGLQDQLLSTVVTHEVPHLEDQRSKLLESISLDAITLEELEEKTLNLLQKALGSILDDDKI 3568

  Fly  3713 VMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKA 3777
            |..|.|:|.|::||..::...|....:|.:.|:.|.|.|.|.:::||::.||.:||.:|||||..
Human  3569 VDTLRKSKMTSNEISKRIEATKKAESEIQAIRKNYLPIATRGALLYFLVADLTQINYMYQFSLDW 3633

  Fly  3778 FTVVFNNAMLK-------AMAAEK------------------------LKDRVENLIDSITFCSF 3811
            |..||.::::.       :...||                        |...:::.||.:|...|
Human  3634 FHQVFVSSVVSKSKEQEHSFKREKVSPKEVHEFISISKEPNLENEKNLLDKHIKSAIDMLTKSIF 3698

  Fly  3812 VYTSRGLFEQDKLIFLTQLCIQILVN--LGEVEPTELDFL------------------------- 3849
            ...|..||.:|||.|..:||..|:.|  .|.:...::.||                         
Human  3699 KVVSSALFNEDKLCFSFRLCTVIMQNNANGNLIQDDIGFLPEEEWNIFLYSGILINIKSALSQSR 3763

  Fly  3850 LRFPYMPNQTSNFTWLTHVGWGGIRALNNQ-AVFKGLEKDIEGSHKRWKKFVDSES--------- 3904
            |...:...::.:..||:...|...:.::.. ..|..|.|.:..:..:|..|.:|::         
Human  3764 LTSTFEIGESQHLQWLSDSRWRQCQYVSTHLEPFSLLCKSLLSNVSQWDTFKNSKAVYSLISTPF 3828

  Fly  3905 -------PENEKFPGE-----------------WKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEK 3945
                   .||.|.|.|                 |:..::.|||.:::.:||:.::.::|.||.||
Human  3829 SSENASLEENTKPPEETELLNENKETCNPINFPWEKLTSFQRLILVKVLRPESLNNSVRKFITEK 3893

  Fly  3946 LGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQ 4010
            :|:||:....:.....::.|:..|.:..:.:.|:|....:.:..:.|..:..|...  :|||:.|
Human  3894 MGNKYLQRTGVNLKDAYKGSNARTPLILIQTHGIDLTNILLRFAQELKGTTHHVTI--ISLGRDQ 3956

  Fly  4011 EIVAENAI-EIASQYGHWVILQNIHLVARWLPSLEKKMESSLS---NVHTSYRLFLSAEPAGDPA 4071
            ...||:.| :..::...||.|||.||...::|.|...:||..|   .:...:||:||::....  
Human  3957 AAKAEDLILKALTKTQQWVFLQNCHLATSFMPRLCTIVESFNSPNVTIDPEFRLWLSSKSYSS-- 4019

  Fly  4072 AHILPQGILESAIKITNEPPTGMMANIHKALDNF----SDETLEMCSKETE----FKAILFSLCY 4128
               .|..:|:..:||..|.|.|:.:|:   |..|    |.|..|...:..:    :|.:|||||:
Human  4020 ---FPIPVLKKGLKIAVESPQGLKSNL---LQTFGCTGSGEVTEEIFENPDCGQWWKKLLFSLCF 4078

  Fly  4129 FHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDD 4193
            |:||:.||:.:|..|||.:|.||..||.:::.||.|.|.....:.|:.||||.||::|||.:.|:
Human  4079 FNAVINERKNYGILGWNIAYKFNSSDLGVAIKVLENSLRGQPSISWQALRYLIGEVIYGGRVIDN 4143

  Fly  4194 WDRRLCRTYLEEFMQPELIDGELEYCQG---FPAPGILKYTGYHNYI----DDNLPSESPSLYGL 4251
            ||:|..:|.|.:|..||::..:..:...   .|.||......|.:.|    ||:|    |.:.|:
Human  4144 WDKRCLKTLLYKFCNPEVLKDDFSFSSDGICLPVPGSASIKDYIHIIQSLPDDDL----PEVLGI 4204

  Fly  4252 HSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETV--------SQEDIIKNIIEDILDKTP-- 4306
            |..|......|..|:....:..:||:.|       |.        |:::::..|:.|:|.:.|  
Human  4205 HPEAIRSCWETQGEKFIENLIAMQPKTT-------TANLMIRPEQSKDELVMEILSDLLKRLPLT 4262

  Fly  4307 ---------TPFNILELMG---------RVEDRSPYI---IVAF--QECERMNNLMTELKRSLNE 4348
                     ||..:..:|.         .::|..|.|   ::.|  ||.:|.:.|:..:.:||.:
Human  4263 VEKEEIAVGTPSTLKSMMSSSIWESLSKNLKDHDPLIHCVLLTFLKQEIKRFDKLLFVIHKSLKD 4327

  Fly  4349 LDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVA---- 4409
            |.|.:|||:.::..:|::.......:||..|.|.||.|...|.||..||:.||.....|..    
Human  4328 LQLAIKGEIILTQELEEIFNSFLNMRVPTLWQKHAYRSCKPLSSWIDDLIQRLNFFNTWAKVAYT 4392

  Fly  4410 --------------------------------DF--RMPSSIWLAGFFNPQSLLTAIMQQTARKN 4440
                                            :|  ..||..||..||.||:.|.|::|...|..
Human  4393 AIQRRYMRFVTVWKQSIPSTSQKCKHPEDSENNFFEGFPSRYWLPAFFFPQAFLAAVLQDYGRSR 4457

  Fly  4441 EWPLDRMCLN----CDVTKKWKEELTTAPRE----------------GAYINGLFMEGARWDMKM 4485
            ...:|.:...    .:.|.|.::.....|::                |.||.|||:|||||:.:.
Human  4458 GIAVDALTFTHHVISNTTDKDEKFSVFMPKKLNIVRRAFKGSASSHTGVYIFGLFIEGARWNREQ 4522

  Fly  4486 GTIADAFLKELFPAMPVLYI-------KAVTQDKQDIKNVY--ECPVYKIRLRG--------PT- 4532
            ..:.|:...|:....|.:|.       |......|....:|  |||||:...|.        || 
Human  4523 KILEDSLPLEMCCDFPDIYFLPTKISTKTPNASNQTDSELYAFECPVYQTPERSRILATTGLPTN 4587

  Fly  4533 FVWTFNLKSRERASKWTLAGVCLLLQ 4558
            |:.:..|.:::..|.|....|.||.:
Human  4588 FLTSVYLSTKKPPSHWITMRVALLCE 4613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 83/425 (20%)
DHC_N2 1368..1770 CDD:285579 116/425 (27%)
P-loop_NTPase 1903..2132 CDD:304359 124/229 (54%)
P-loop_NTPase 2217..2352 CDD:304359 62/207 (30%)
P-loop_NTPase 2510..2783 CDD:304359 95/360 (26%)
P-loop_NTPase 2860..3127 CDD:304359 72/278 (26%)
MT 3140..3480 CDD:289543 100/347 (29%)
AAA_9 3509..3722 CDD:289547 84/215 (39%)
Dynein_heavy 3864..4549 CDD:281078 217/847 (26%)
DNAH14NP_001354408.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.