DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah10

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_008767494.1 Gene:Dnah10 RGDID:619988 Length:4592 Species:Rattus norvegicus

Alignment Length:4800 Identity:1480/4800 (31%)
Similarity:2424/4800 (51%) Gaps:532/4800 (11%)


  Fly     3 DEKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQ 67
            :|.|::|....:.|.......|..:.|.|..|..:...|..:..||..:.|..||::..|.:..:
  Rat    81 EEGEEEESEYQKVEVTDKTAVKPSKPKNDSLTPPLFDMEDDEPDIENYSKPYNKRLVKRIINRLE 145

  Fly    68 LYPSYSFPVRPRY---KVAYFIR-----------YLTPLHLTDENM----LNSLLIGDLLPNPLA 114
            |:.|.: |:...:   .|.:|:|           ....:.:..|.|    :||.::..|      
  Rat   146 LHVSLT-PLSEEFLEQNVVFFLRSSKDAIPEASDMKEAMEIMPETMEYGIINSQVLQFL------ 203

  Fly   115 NLSILCDEVFFPLLNNTVNQVGWTNVIANDMKTESQEMRN----------GIAQMKGLV------ 163
             ..|:| :||.|.|:            .|..|:||.::.:          .|..:..::      
  Rat   204 -KDIIC-QVFMPALS------------FNQHKSESGQVASPPEVQEFSSYDITDLPSMLGETMEY 254

  Fly   164 --------------------INRTIFPLPICMDEVMQAAPAIAM-GDIS--VVNPLMKHSLEFMV 205
                                |.||:..|.   .|:....|:|:: |::|  |.:|.:..:||..|
  Rat   255 HSIQLIRDEFLMNLQKFANNIQRTMQQLE---GEIKLEMPSISVEGEVSELVADPELVETLEQCV 316

  Fly   206 VKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQ 270
            :.||..:...|:.:..:|  .:.|.||.|  ..||..|...|..|.||.....::.:..|:::.:
  Rat   317 INWLGQISYAVDSQLKKK--PQGNGPLAE--IEFWRERNATLSALYEQTKLPFVRKVLEVIKEAE 377

  Fly   271 SIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLT-IGLVWGHS 334
            |:...:.:.::..:.:...||.|..:.||.::|...............|..|.|:: :.:||..|
  Rat   378 SMLTANVQPVLTELFKLHMEASDNVRFLSTVERHFKNITHGSNFHVVLDTIPSMMSALRMVWIIS 442

  Fly   335 RYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNS 399
            |:::....|..........:.:.|.|.:...::|:.:...|..|.......|:.:|..|.:.|  
  Rat   443 RHYNRDERMIPLMERIAWEIAERVCRVINLRTLFKENRANAQFKTQEAKNTLKLWKKSYFDIR-- 505

  Fly   400 LKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKL----EKIVMGGLKGRQ 460
               .||..:.....|.:.:..:|.|.|......::|.|:...:.:|..:    .|.|.|..|   
  Rat   506 ---AKIEASGREARWEFDRKRLFERTDYMANICQDLSDILRVLEEFYNIFGPELKAVTGDPK--- 564

  Fly   461 ITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRL-SFKAKTDVMERMV------SFQF 518
               .::.:|...:|:......:.::|.  :..::.:.:..: .||.:..|:|:..      ||:.
  Rat   565 ---RIDDVLCRVDSLVAPMETLNFDPF--NIRSAPYWKYVMEDFKLEVLVIEKEAKNFIDESFKT 624

  Fly   519 EKGLEDTHDLLLA-GSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLNELP 582
            .:..|...|:||. ..:..|..|.:.:....:.|:..:.:||..|.|.|        ...|:..|
  Rat   625 LRSAEAAFDMLLKFKHIRSREAINRQMMMKFNDILAQYYKEIDIVNKIF--------EQNLDNPP 681

  Fly   583 TDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEY----PLFDNERGGYVSDIFNIMVQEIDDFTK 643
            .....|.|:|||.:.:.|.:||     :|.:..:    .|.|:|||..|...:..:.:::.::..
  Rat   682 LYKNHPPVAGAICWERSLFYRI-----KHTILRFMEVEELLDSERGQEVKQRYLEVGRKMKEYED 741

  Fly   644 MLLDKWTVECWQGIQQDITLTLIEK-----------DEANELRVNFTERLIFALKDIKVVRLLGC 697
            :..:.|.....|.:...:..:|:.|           |......:||:..|...:.:.|.:..||.
  Rat   742 VKYEHWKETTEQSLPNLMKKSLLTKNTITSEDSAVIDRGTMFVINFSPVLREIINETKYLEQLGF 806

  Fly   698 DVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDF--- 759
            .|.........:||       |.:|..|......:..|.....|..||.:|:::..:.||..   
  Rat   807 TVPELARNVALQED-------KFLRYTEGIQRMLDHYHLLVNTLNEAESVLLDDHSQELLRVFRS 864

  Fly   760 ----IKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHT 820
                :.||:                    :...:.:...|::|   ||   |:.       |:|.
  Rat   865 GYKRLNWNS--------------------LGIADYITRCKQAI---GK---FES-------LVHQ 896

  Fly   821 DPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSV 885
            ..:         ||.|....:.|:..:||   |..|                             
  Rat   897 IHK---------NAEDINSRLTLIESINL---FRSP----------------------------- 920

  Fly   886 MTSVKFKKKREVIDEEDDL-------EEFEEEQSESEEEIITPFHRYELLKG--LSQEE------ 935
                       ||..||.|       |..|.|:|...:.::    |:.:..|  |::.|      
  Rat   921 -----------VIKTEDKLPGVKEFFEYIERERSRDVDHMV----RWYMAIGPLLTKVEGLVVHT 970

  Fly   936 -------RALFREY---EIY--VDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQE 988
                   .|.:.||   :||  :.::|.:||   ...:|..||         |.|:|:....|..
  Rat   971 NTGRAPKLASYYEYWEGKIYDVLVKLILKNL---QAFNSLILR---------NVPLFQAETILSA 1023

  Fly   989 PNVVYFRNLDTSSK------TGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQD 1047
            |.::...|.:...|      .|.....:..:..||...........:..|:..:   |||:::..
  Rat  1024 PEIILHPNANEIDKMCVHCIRGCVEVTKYFVRWMNGSCIECPPQKGEEEEIVII---SFYNDISQ 1085

  Fly  1048 KSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADL 1112
            .|::..|.|.|...|...|..:..:.:.:..:..||..|||..:   :||               
  Rat  1086 NSQIMDQAVMIPQNIHRLLVNIMKYLQRWKRYRPLWKLDKSIVM---EKF--------------- 1132

  Fly  1113 EGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWI 1177
                     ..:.||...|.|:|..:.::...:......:|... :||.:......|......|:
  Rat  1133 ---------AAKKPPCVAYDEKLQFYAKIAADVMRHPLVKDEHC-IRLQLEPLANTVQENAKSWV 1187

  Fly  1178 -SLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDP 1241
             ||.|| |....:..|..|:|.::  ::...::...:..:.|..:|:.:::|..|..|.:..:..
  Rat  1188 TSLGKL-LNESAREELYSLRDEIE--HLAKNLKKSPNTLDDLKFVLATISEIRTKSLIMELRYKD 1249

  Fly  1242 LKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNM 1306
            ::|....:..|:....:.|...::.:.:.|..:...:...:..:..|:....::....|:...:.
  Rat  1250 VQERYRTMAIYSIFPPEAEQELVDNIENMWETLFTDSVNVEHALGGIKRTFTEITRSEIINYRSQ 1314

  Fly  1307 ANTYRKKFLSKKFFFVPCL------SCYELIDESDLELVALEERQRSLAESAVLFEL---QGPDP 1362
            .:.:.|:|.|:.    |..      ...||:...:.||...|:.::.||.:..||:|   ..|:.
  Rat  1315 VDEFAKRFYSEG----PGAVGEDLDKGSELLGSFEKELARHEKNRQELANAEKLFDLPITMYPEL 1375

  Fly  1363 VKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWE 1427
            :|::.....|:::..::|   :::....:|.:|.|..::::.:.:..:.|.:.||.|.:.:|:..
  Rat  1376 MKVQKEMAGLRMIYDLYD---SLKIAKEEWSQTLWINLNVQYLQEGIEGFLKNLRKLPRHVRSLS 1437

  Fly  1428 PFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEE 1492
            ....:|..:|....|:..:.:|::.|:|:|||.|||:.|.|.|.|.::.||.::..:.||::.|.
  Rat  1438 VAFHLETKMKAFKDSIPLLLDLKHEALRERHWKELMEKTGVFFEMTETFTLDNMFAMELHKHTEV 1502

  Fly  1493 VKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEE----------LIETLED 1547
            :..||..:|||:|:||.:::|...|..|:|       |.:|..|.::|          :|:.|:|
  Rat  1503 LNEIVTAAVKEVAIEKAVKEILDTWENMKF-------TVVKYYKGTQERGYILGSVDDIIQCLDD 1560

  Fly  1548 HQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPED 1612
            :...||:::.|:::..|...|..|:..||...::|..|..|||||.||||||||. ||||||||:
  Rat  1561 NTVNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGG-DIRSQLPEE 1624

  Fly  1613 SRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYP 1677
            :::||.||:.||.::.....| .|::....:.::|:: |:.:.:.|..|:|:|||||::||.::|
  Rat  1625 AKKFDVIDRIFKRIMGDTLKD-PVIKRCCEAPNRLHD-LQTVSEGLEKCQKSLNDYLDSKRNAFP 1687

  Fly  1678 RFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL---ISGSKNAAGMVAKELEEYVPFLE 1739
            ||:|:|..:||.||.| ::|..|..|:.|:||::..|..   .||.|..:.|::.|.|..| |.:
  Rat  1688 RFFFISDDELLSILGN-SDPLCVQEHMIKMYDNIAMLRFHDGDSGEKLVSAMISAEGEVMV-FRK 1750

  Fly  1740 NCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFY-DHKPRHVWIFEWPAQPALVGTQIMWTTETN 1803
            .....|:||.|:..:.::||.|.|...|.::..| :.:.|..|:..:.....|..:|:.||.|..
  Rat  1751 IVRAEGRVEDWMTTVLNEMRRTNRLITKEAIFRYCEDRSRVDWMMMYQGMVVLAASQVWWTWEVE 1815

  Fly  1804 DAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKK 1868
            |.|.||:|..:.|:|:|.||...|:::|:..:...|:..:|:|..|:..||||:||:|.:.|...
  Rat  1816 DVFNKVKQGDKQAMKNYGKKMHRQIDDLVTRITMQLSKNDRKKYNTVLIIDVHARDIVDSFIRGS 1880

  Fly  1869 VEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHL 1933
            :.....|:|:||||..||.:.|:.....|...|.|.|||:|...||||||||||.|:||||:|.:
  Rat  1881 ILEAREFEWESQLRFYWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSM 1945

  Fly  1934 VMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRI 1998
            .:|||||||||||||||||||.:|||::..|.||.|.||||::|.|..||||.||||||||||||
  Rat  1946 YLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRI 2010

  Fly  1999 SVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRP 2063
            ...||||::.|::.|::|:..:..||.|.|:.|:|.:.:|:|||||||||||.||||::|||:||
  Rat  2011 DASVLSVISSQIQTIRNALIHQLTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRP 2075

  Fly  2064 CAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGAL 2128
            ..::|||...|.||||.:|||..|:.||:|...||.|.:|.||||.|||:||||:|||||:||.|
  Rat  2076 VVVIVPDLQQICEIMLFSEGFLGAKTLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGEL 2140

  Fly  2129 RRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDL 2193
            :|......||.||||||||.|:||.|.:|||:|:|||.||||.||.||.|.|:|...::      
  Rat  2141 KRGSADLQEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVE------ 2199

  Fly  2194 KLQPEDGFIL------KIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLN 2252
            .:..|:|::|      |:||:.|....||:..::|..|.|||.|..||.:.............||
  Rat  2200 DVLEENGYVLLPVQVDKVVQMFETMLTRHTTMVVGPTGGGKSVVINTLCQAQTKLGILTKLYILN 2264

  Fly  2253 PKAVTNDELFGIVNPSTREWKDGLFSILMRD-QANLGGTGPKWIVLDGDIDPMWIESLNTVMDDN 2316
            ||||:..||:||::|:||:|.||:.|.:.|: .........|:|:.|||:|.:|:|::|:|||||
  Rat  2265 PKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDN 2329

  Fly  2317 KVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSE 2381
            |:||||:.|||.|.....||||:..|:.|:||||||.|::|::|::|.:.|:.:.||....|..|
  Rat  2330 KLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWKKWLQQIQNKVE 2394

  Fly  2382 VSMLNVLFDKYVPPLLDIF---------RTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCP 2437
            ...||.||:||||.|:|:.         ..:|:.:.|.:|:..:.....::||:|  :....|  
  Rat  2395 QKYLNDLFEKYVPILIDLIIEGILDGRQGEKLKMVVPQTDLNMVTQLTKMMDSLL--EGEIED-- 2455

  Fly  2438 KDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSG-------------TIF 2489
            .|..|.:|:..:....||||.::..|    :|.:...|..........|             |::
  Rat  2456 PDLLECFFLEALYCSLGSSLLEEGRI----KFDECIKNLSSMPTAETEGNWARPGELPGHLPTLY 2516

  Fly  2490 SFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSG 2554
            .|:.|.:...:.||..|||::..:........||:|.:|||..:.::.:::..||::.:|.||:.
  Rat  2517 EFHFDSKRNYWIPWNKLVPEYVHNHQKRFVDILVHTVDTTRTTWILEQMVKIKHPVLFVGESGTS 2581

  Fly  2555 KTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMN 2619
            ||......|..|..:...|..|.|:..|||..:||.||..:||:....|||...||::.|:||||
  Rat  2582 KTATTQNFLKNLNEETNIVLMVNFSSRTTSLDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMN 2646

  Fly  2620 MPEVDKYFTVQPHTLIRQFMDYHHWYDRQK-MTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFC 2682
            ||:||:|.|.||..|::..::..:.|||.| :..:.|.....:|.|..:.|... :|||....|.
  Rat  2647 MPKVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFLSLFS 2711

  Fly  2683 SFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFH 2747
            .|.|..||:::|..|..|||..|...    |.:::..:...:....:||:..:|....||..|||
  Rat  2712 VFNVPFPSEESLHLIYYSILKGHTST----FAESISGVSRKLTFCTLTLYKNIVQDLPPTPSKFH 2772

  Fly  2748 YNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKG 2812
            |.|||||::.:|.|::.:|.:.....:||:|:|.:||.||:.|:|::..|    |::|.|.:...
  Rat  2773 YIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVD----KQLVQDYIGNL 2833

  Fly  2813 I-EGVNDD--VVYAQPLIYCHFAKGLTDIK---YMPISGWDRLKSLLDEAQDRYNDYIGAMNLVL 2871
            : |..|||  :|...|:::..|...|.:.:   |..|..::..|:|.:|..:.||:....|||||
  Rat  2834 VKEHFNDDYEMVMRDPILFGDFRTALQEEEPRIYEDIQDYEAAKALFEEILEEYNEVNTKMNLVL 2898

  Fly  2872 FDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANI 2936
            ||||:.|:.|:.||:...||:|||:||||||||||.|||:|.:..:||:|.|::.||.::.:.::
  Rat  2899 FDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFTAGYEVFEILLSRGYSENNFRDDL 2963

  Fly  2937 ATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLG 3001
            ..||||.|::.....||.||:.||.|.||.|:|::|.||.:..||.::|.:||::.:..|..:.|
  Rat  2964 KNLYMKLGLENKLMIFLFTDAHVAEEGFLELINNMLTSGMVPALFTEEEKDNILSQIGQEALKHG 3028

  Fly  3002 IVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSL 3066
            :...:|:.|::|:.|..:.|.:||..||||.|||.|.|.||.|||.|.||||..||.|||.:|:.
  Rat  3029 MGPAKESVWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAK 3093

  Fly  3067 RFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKV 3131
            .||...:::|.|....:...:..||::|.:.||.:....:|.||.|||::|:.|..|||||.||.
  Rat  3094 SFLGNNSMIPSEKLEDLVEHVVLVHQSVGEFSKQFQQKLRRSNYVTPKNYLDFINTYSKLLDEKT 3158

  Fly  3132 KANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGT------ENEKV 3190
            :.|:.:..|||.||.||...|.::|.|...|..|::.|..|:...:.|:..:.|      |.:|:
  Rat  3159 QYNIAQCKRLEGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACETLLEEIATNTAIAEEKKKL 3223

  Fly  3191 SKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPD 3255
            ::|:|...:|:..:..:|: ..|:..|.|     ..|.|.||:..|..|:|:::||::||..||.
  Rat  3224 AEEKAIEIEEQNKIIAVEK-AEAETALAE-----VMPILEAAKLELQKLDKSDVTEIRSFAKPPK 3282

  Fly  3256 AVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDA 3320
            .|.:||..:|::   ||.  |:.:||..:..|.: ..||.:|:..|...|....:|.::..:...
  Rat  3283 QVQTVCECILIM---KGY--KELNWKTAKGMMSD-PNFLRSLMELDFDSITQGQVKNIKGLLKTL 3341

  Fly  3321 EFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTEL 3385
            ..:.|::.|.|.|..|:..:|..:..:.||:..::||...:...|:.....:.:|..:...|..:
  Rat  3342 NTTIEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKRDKVARLERNFFLTKRELERIQNELAAI 3406

  Fly  3386 EEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPG 3450
            :::|.||..:|:.|:.:|||.|:||......:..|::||.||.:|.:||:..:..|.....:|.|
  Rat  3407 QKELEALGAKYEAAILEKQKLQEEAEIXERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLG 3471

  Fly  3451 DILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPF---EMICDDAQIAEWNN 3512
            |.|:.:.|:||.|.||..:|..:..:.|.....:...|:.     .||   .::.||.:|:.|.:
  Rat  3472 DCLLCAAFLSYEGAFTWEFRDAMVNQEWRNDILDRDIPLS-----QPFRLENLLTDDVEISRWGS 3531

  Fly  3513 QGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVSN 3576
            ||||.|.:|.:|..:..::.|:||.||||.|.:.|:|.| ....|.|...:..::|.|:|.::..
  Rat  3532 QGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEERNNLRVASFNDPDFLKQLEMSIKY 3596

  Fly  3577 GSVLLIENIGENIDPVLNPLL--------GRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPH 3633
            |:..|..::.|.||||::.:|        |||.|      .:||:|:|::|.|||.|:||||||.
  Rat  3597 GTPFLFHDVDEYIDPVIDNVLEKNIKISQGRQFI------ILGDKEVDYDSNFRLYLNTKLANPR 3655

  Fly  3634 YKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLAR 3698
            |.|.:..:..:||:|||..|||||||:.:|..||.:||..|..|.|:.:..|..||.|||.||..
  Rat  3656 YSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRE 3720

  Fly  3699 LSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILND 3763
            |:::..|:|::|.||..||:||..|.|:..|:..|:.|.:.||..|:.|||||.|.:|::|:|::
  Rat  3721 LATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSE 3785

  Fly  3764 LFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLT 3828
            :..:|.:||:||.||..||..::.|::....|..|::|::|::||..:.|...||||:.||:|..
  Rat  3786 MALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKNIMDTLTFNIYNYGCTGLFEKHKLLFSF 3850

  Fly  3829 QLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNF----TWLTHVGWGGIRALNNQ--AVFKGLEK 3887
            .:.|:|....|.|...||||.|: ..:..:.|.:    |||:..||..|..|:.:  .:|..|..
  Rat  3851 NMTIKIEQAEGRVPQDELDFFLK-GNISLEKSKWKKPCTWLSDQGWEDIILLSEKFSDIFGNLPF 3914

  Fly  3888 DIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYI 3951
            |||.:...|:::.|.:|.|...||..:... :|.|:|.|:||.|.||:..|:..::...:|.||:
  Rat  3915 DIEHNLPTWQEWYDKDSLEQFPFPLRYDDHITAFQKLLILRCFRVDRVYRAVTDYVTLTMGEKYV 3979

  Fly  3952 DARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAEN 4016
            ....:.|...||:|:|.:.|.|:||||.||..|:.||.:..||......|  :::|||||.||..
  Rat  3980 QPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERSGFGGTRLKF--LAMGQGQEKVALQ 4042

  Fly  4017 AIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILE 4081
            .:|.|...|.|::|||.||:.:||..|||.:| .::..|..:||:|:.:|...     .|.|||:
  Rat  4043 LLETAVARGQWLMLQNCHLLVKWLKDLEKSLE-RITKPHPDFRLWLTTDPTKG-----FPIGILQ 4101

  Fly  4082 SAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNR 4146
            .::|:..|||.|:..|:.......|.:.||.| ..|.||.:::.|.:|||||.||||||..|||.
  Rat  4102 KSLKVVTEPPNGLKLNMRATYFKISHDMLEQC-PHTAFKPLVYVLAFFHAVVQERRKFGKIGWNV 4165

  Fly  4147 SYPFNVGDLTISVYVLYNYL-----EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEF 4206
            .|.||..|..:.:.:|..||     :.:.|:||..|:||.||:||||...|.:|||:..||::|:
  Rat  4166 YYDFNESDFQVCMEILNTYLTKAFQQHDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEY 4230

  Fly  4207 MQPELIDGELEYCQGFPAPGILKYTGYHNY----IDDNLP-----------------SESPSLYG 4250
            :...:.|               .:..:|.:    :|..:|                 :.:|.::|
  Rat  4231 LGDFIFD---------------TFQPFHFFRNKDVDYKIPVGDVKDKFVEAIEALPLANTPEVFG 4280

  Fly  4251 LHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELM 4315
            ||||||||:.|..:..::..:.||||: ||.||.|  ||::|.|..:.:||.:|.|..|::.::.
  Rat  4281 LHSNAEIGYYTQAARDMWGHLLELQPQ-TGESSSG--VSRDDYIGQVAKDIENKMPKIFDLDQVR 4342

  Fly  4316 GRVE-DRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQW 4379
            ..:. :.||..:|..||..|.|.|:..:.|||.||...|.||:.:|:.::|:...|::..:|..|
  Rat  4343 KHLGLNISPTSVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDDVARSLFLGHIPHIW 4407

  Fly  4380 TKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPL 4444
            .|||..::..|.:|....:.|..:...||.:.. ||.:||:|...|:|.|||::|.|.|:|.|||
  Rat  4408 RKLAPDTLKTLGNWMVYFLRRFNQYTLWVTESE-PSVMWLSGLHIPESYLTALVQATCRRNGWPL 4471

  Fly  4445 DRMCLNCDVTK-KWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAV 4508
            ||..|...||| :..:|:.....:|.:::||::|||.||::.|.:..:..|.|...:|:|.|..:
  Rat  4472 DRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPI 4536

  Fly  4509 TQDKQDIKNVYECPVYKIRLR----GPTFVWTFNLKSRERASKWTLAGVCLLLQT 4559
            ...:..::|.:..|||...:|    |...|:..:|.:.:..|.|.|.||||.|.:
  Rat  4537 EGHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTAKHISHWVLQGVCLTLNS 4591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 119/601 (20%)
DHC_N2 1368..1770 CDD:285579 135/415 (33%)
P-loop_NTPase 1903..2132 CDD:304359 142/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 60/136 (44%)
P-loop_NTPase 2510..2783 CDD:304359 90/275 (33%)
P-loop_NTPase 2860..3127 CDD:304359 119/267 (45%)
MT 3140..3480 CDD:289543 99/346 (29%)
AAA_9 3509..3722 CDD:289547 91/222 (41%)
Dynein_heavy 3864..4549 CDD:281078 244/720 (34%)
Dnah10XP_008767494.1 DHC_N1 307..879 CDD:285571 120/629 (19%)
DHC_N2 1378..1781 CDD:285579 135/418 (32%)
P-loop_NTPase 1915..2143 CDD:304359 142/228 (62%)
P-loop_NTPase 2231..2366 CDD:304359 61/135 (45%)
P-loop_NTPase 2548..2808 CDD:304359 90/264 (34%)
P-loop_NTPase 2887..3154 CDD:304359 119/267 (45%)
MT 3166..3500 CDD:289543 99/346 (29%)
AAA_9 3528..3744 CDD:289547 91/222 (41%)
Dynein_heavy 3885..4581 CDD:281078 245/724 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.