DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah9

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_002724553.1 Gene:Dnah9 RGDID:621799 Length:4487 Species:Rattus norvegicus

Alignment Length:4628 Identity:2324/4629 (50%)
Similarity:3133/4629 (68%) Gaps:226/4629 (5%)


  Fly     4 EKEKKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNN-------PNKKRIIFT 61
            |...:||.|.|......::.:::|.....|.:...|.|...::..||::       |     :..
  Rat    12 ESGDEEPGDPRLRLLGTFVARSLRPAAGTWERCAGTAEAGRLLQAFLDHNAAAGPCP-----LLV 71

  Fly    62 INSG-GQLYPSYSFPVRP-----------RYKVAYFIRYLT--PLHLTDENMLNSLLIGDLLPNP 112
            :.|| |.|.      |||           |.|..:|:|..:  |   .:.::..::|.|||...|
  Rat    72 VQSGPGGLV------VRPGLDAGPEPNQARAKGLFFLRTRSEPP---GNHSLRGTVLCGDLPAVP 127

  Fly   113 LANLSILCDEVFFPLLNNTVNQVGWTNVIANDMKTESQEMRNG----IAQMKGLVINRTIFPLPI 173
            |.:|:.|..||..|:|:|..|.:.|.:::..|::..:..:::.    :..|||    ||:.|||:
  Rat   128 LEHLAPLLSEVIIPVLDNEKNHLDWPHMVCQDIRHHAHSLQSDLLVILEHMKG----RTLLPLPV 188

  Fly   174 CMDEVM----QAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPE 234
            ..::|.    |:.|.:...|.|.|     :::|..|:||...|:.::..::.:.:...|. |.|:
  Rat   189 GSEKVEFVDGQSEPVLDSIDKSTV-----YAMESAVIKWSHQVQVVLKRESSQPLIQGEK-PTPK 247

  Fly   235 AIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLS 299
            ....||:||.|:||::..||...:::.:..:|:|:||.:..:::.:.:.|..:|.||:||...|.
  Rat   248 VELEFWKSRCEDLEHIYNQLMTIKVRGMAGLLDKLQSSYLPAFKAMFQDVEAALTEAQDIRVHLL 312

  Fly   300 PLKRKMDKFETNDMDENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEP 364
            ||::.:|..|..:..|.:..:|||:..:.|:|.:.:::.:...:|:......|.||...:..:.|
  Rat   313 PLQQHLDILENMEFPEVKGRLRPLLHVVCLIWANCKWYRSPGRLTVLLQEICNLLIQQASNYLSP 377

  Fly   365 DSIFQGDVDEAYKKLDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQD-----WTWHQDEIFGR 424
            :.:.:.:|:|:.:||.|....|.::|..:.:.|..|.      |:..:|     |.:....:|.|
  Rat   378 EDLLRSEVEESQRKLQIVSDTLSFFKQAFQDRREHLH------TYFKEDSEVRAWDFQASLVFVR 436

  Fly   425 LDKFLVRLEELKDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDP 489
            ||.||.||..::||..|..||.||||:...||:|..::..::::.||:..:|:.:.:..|:.::|
  Rat   437 LDGFLGRLRMVEDLLKTALDFNKLEKLEFSGLRGNSLSQKVQQMHEEFEEMYKVFLDCSYDCLNP 501

  Fly   490 DAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHD-------LLLAGSLLLRPIIKKHVEPL 547
              |:..|:.|...|..:.:.::|.:.....:..:|..:       |.:.|:|:.||::.:.|...
  Rat   502 --ESMEFENDVCGFNKRVEDLDRRLGTILIQAFDDVPEVEHAFKLLDITGTLVERPLVAQDVSHK 564

  Fly   548 MHVIVDDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHE 612
            ...::..|..|:..|:  .|..:::...:.....|.....|.::|.|.:.::||.||.|.....:
  Rat   565 YLALIRMFNTELDAVR--IIYSQHIREEVEHGFSPVHKNMPTMAGGIRWAQELRQRIKGPFSNFK 627

  Fly   613 LYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKDE-ANELRV 676
            ...:....:..|..:...:..::..::::.:.|.:.|.....:..|::::|.|:.:|. ..:|.|
  Rat   628 NIPHWCLQSAEGKRMIQKYEDLLTLLEEYERRLYEDWCQTVSEKSQRNLSLPLLHRDPITKQLSV 692

  Fly   677 NFTERLIFALKDIKVVRLLGC-DVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKR 740
            ||..:||..||::..::.... .:.......|...:...|....|..:|.|||.........|..
  Rat   693 NFNSQLISVLKEMNYLQPTEVKPIPETAAAMFSSREFYRQLVANLELMANWYNKVITTLLEVEFP 757

  Fly   741 LIAAEMILIEEQMKPLLDFIKWNAFS-QRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKV 804
            |:..|:..|:.:::...:.:.|.... ..:.:.|...:..|..|:...::|:|.|:..:::|.. 
  Rat   758 LVEEELQNIDLRLRAAEETLSWKTEGIWDYAMQITNSIHDLERRIQKTKDNVEEIQTIMKTWVS- 821

  Fly   805 PLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEE 869
            |:|:|||......|..|                                                
  Rat   822 PIFKRKDGKKECPLSLD------------------------------------------------ 838

  Fly   870 DEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQE 934
                                         |::|.||::.....||..:|          ..|.||
  Rat   839 -----------------------------DQQDLLEKYYSLIRESGLKI----------HALVQE 864

  Fly   935 ERALF------REYEIYVDEIIAENLVDSVITSSTYLRMEVDNRY--ENN------TPIFEIFME 985
            ...||      ..::.||..|      ||::....:|.:|...:|  ||.      |||||..:.
  Rat   865 NLVLFAADPASSTWKSYVGHI------DSMLLDGFFLAIECSLKYLLENTECKPGLTPIFEAQLN 923

  Fly   986 LQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYS----FYDELQ 1046
            |..|.:|::.:||:..|.|....::          ||:..:...|:.|..::|:|    :..:|:
  Rat   924 LVTPELVFYPSLDSGVKGGLYDIVQ----------SLVTSIFAVPSLVPRLSPHSGSPHYQGDLE 978

  Fly  1047 DKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEAD 1111
            :.::|...|..::.:::..:.....:.....::|.|::.|:...|.:...:|..||.:|.:|..:
  Rat   979 EMADLASLRSLLLERVQTMMTLCCSYRNTLSQYSYLYVEDRKEALGQFLLYGHVLTPEEIEAHVE 1043

  Fly  1112 LEGSSGVKLLGLEYPP-LSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQ 1175
                .|:.    |.|| |..:|:|:|.:.:|.:.:.:.|..:.|..::|:::..||.::|:.:.:
  Rat  1044 ----DGIP----ESPPLLHHFKDQIDSYEKLYEDVVSLEPSKVFDGWMRVDVRPFKASLLNTIKK 1100

  Fly  1176 WISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFD 1240
            |..:||..|::.|.|||.:|..|:......|...::|.||:|||:|:..|..:.|:|...|.||:
  Rat  1101 WSLMFKQHLVDFVTNSLADLDSFIKSTECGLLKRVEKGDFQGLVEIMGHLVTLKERQSSTDDMFE 1165

  Fly  1241 PLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDN 1305
            |||:.|:||:.|..|..:|...|:.|||:.|..||::|.|.:|.:||:|:.:|.|:.:|....|:
  Rat  1166 PLKQTIELLKSYEQELPETVFKQLEELPEKWKNVKKMAITVRQQVAPLQANEVALLRQRCSAFDD 1230

  Fly  1306 MANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRF 1370
            ....::::|..:..|....::.::::|...:|:..:|....::::||.|||:..||..::..||.
  Rat  1231 EQQQFQERFHKEAPFRFDSINPHQMLDVWHMEIQHMESTMATISKSADLFEVNVPDYKQLRQCRK 1295

  Fly  1371 DLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEAS 1435
            :...:|.:||....:.|:|..|:.|.|:.|.:|.||.|||:|.|::|.|||..|||:.|..:|::
  Rat  1296 EACQLKELWDTIGMVTSSIQAWEATSWRNISVEAMDSECKQFARQIRNLDKEFRTWDAFTGLEST 1360

  Fly  1436 LKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKS 1500
            :.|.:||||||.||||||||:|||.:|||.|.|.|:||..|||..|:.|.||.:|:||::|||::
  Rat  1361 VLNTLTSLRAVAELQNPAIRERHWRQLMQATGVNFTMDRDTTLAHLLQLQLHHFEDEVRDIVDRA 1425

  Fly  1501 VKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFE 1565
            ||||:|||.|:::.|.|.:|||..:.|.||.|.||::.|:|||.|||:|.||||:..|||:|||.
  Rat  1426 VKEMSMEKTLKELQTTWASMEFQYETHARTHIPLLQSDEDLIEVLEDNQVQLQNLMMSKYVAFFL 1490

  Fly  1566 HEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQM 1630
            .||..||.:||.||.:|..||||||.|.:||||||||||||:|||:|::||:.||.:|:.|:...
  Rat  1491 EEVSSWQKKLSTADSVISIWFEVQRTWSHLESIFIGSEDIRAQLPQDAKRFESIDSDFRELVYDA 1555

  Fly  1631 NADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGN 1695
            ....|||.:||:||  |||.||.:...|.||||||.:||:||||::|||||:||:|||||||||.
  Rat  1556 QKTPNVVEATNKSG--LYEKLEDIQSRLCLCEKALAEYLDTKRLAFPRFYFLSSSDLLDILSNGT 1618

  Fly  1696 NPALVARHLTKLYDSMGKLNL-ISGSKN----AAGMVAKELEEYVPFLENCDCSGKVEVWLNRIT 1755
            .|..|.|||:||:|:|.|:.. :..|:|    :.||.:|| ||||.|.|.|||||:||:||||:.
  Rat  1619 APQQVQRHLSKLFDNMAKMQFQLDASQNPTKTSLGMYSKE-EEYVAFSEPCDCSGQVEIWLNRVL 1682

  Fly  1756 DKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDY 1820
            ..|:.|:|.::..::|.|:.|||..|:|::|||.||..|||.||||...|||::::.||||:|||
  Rat  1683 RHMKATVRHEMTEAVTAYEEKPRDQWLFDYPAQVALTCTQIWWTTEVGIAFARLEEGYENAMKDY 1747

  Fly  1821 NKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRW 1885
            .|||:.||..||.:|:|.|:..:|||||||||||||:||||..:||:||:...||.|.|||||||
  Rat  1748 YKKQVAQLKTLITMLIGQLSKGDRQKIMTICTIDVHARDVVAKMIAQKVDNAQAFLWLSQLRHRW 1812

  Fly  1886 DPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTET 1950
            |.:...||||||||||.|.|||||||||||||||||||||||||||||.|.||||||||||||||
  Rat  1813 DDEAKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTET 1877

  Fly  1951 TKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQD 2015
            |||||||||:|||||||||||||||.|:|:|||||||||||||||||||||||||||||||.|||
  Rat  1878 TKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQD 1942

  Fly  2016 AIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLV 2080
            ||:.|||.||||||.|:|..:||:|||||||||||.|||||||||:||||||||||.||.|||||
  Rat  1943 AIRDKKQRFSFLGEEISLDPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLV 2007

  Fly  2081 AEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRAL 2145
            ||||.|||||||||||||.|||||||||||||||||||||||||||:|:|.|..|||||||||:|
  Rat  2008 AEGFIEARLLARKFITLYRLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPDRPEDQVLMRSL 2072

  Fly  2146 RDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEE 2210
            ||||||||||||:|||||||.||||||||||||:.:||||::::.:|||||.||.|:||:|||||
  Rat  2073 RDFNIPKIVTDDMPVFMGLISDLFPALDVPRKRDLDFEAVVRKAIVDLKLQAEDNFVLKVVQLEE 2137

  Fly  2211 LFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDG 2275
            |.||||||||:|.||||||:|.|:|:||||..:.:|.:.|||||||||||||||:||:|||||||
  Rat  2138 LLAVRHSVFIVGGAGTGKSQVLKSLHKTYQIMRCRPVWTDLNPKAVTNDELFGIINPATREWKDG 2202

  Fly  2276 LFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIA 2340
            |||.:||:.||:...|||||:|||||||||||||||||||||||||||||||.|...|||||||:
  Rat  2203 LFSSIMRELANISHDGPKWILLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLLFEIS 2267

  Fly  2341 SLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLR 2405
            .|||||||||||||||||||.||||.|.:.||:..|...:|.:.|.:|||||:|..||..|||.:
  Rat  2268 HLRTATPATVSRAGILYINPADLGWNPPVNSWIDQREVQTERANLTILFDKYLPTCLDTLRTRFK 2332

  Fly  2406 SITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFS 2470
            .|.|:.:.:.:||.||||:.:||.:.||.||||:.||:||||..:|.||||:.|||::|:..|||
  Rat  2333 KIIPVPEQSMIQMLCYLLECLLTKEAVPADCPKEIYELYFVFAAIWAFGSSMVQDQLVDYRAEFS 2397

  Fly  2471 KWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFM 2535
            ||:|.|:|.||||..||:|.:|||.|||||.||..|:||||.|.::|||:.||:|:||.|:.:||
  Rat  2398 KWWLTEFKTVKFPSQGTVFDYYIDQETKKFEPWGKLIPQFEFDPEMPLQACLVHTSETIRVCYFM 2462

  Fly  2536 DTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAG 2600
            :.|:|...|:||:|.:||||::|:.||||:|..::|.|.|||||:||||.|||.:||||||||||
  Rat  2463 ERLMERRRPVMLVGSAGSGKSVLVGAKLSSLNPEEYMVKNVPFNYYTTSAMLQAVLEKPLEKKAG 2527

  Fly  2601 RNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMN 2665
            |||||.||:::|||:|||||||||.|.||||||:|||.:||.|||||.|::|::|.....::|||
  Rat  2528 RNYGPPGNRKLIYFIDDMNMPEVDAYGTVQPHTVIRQHLDYGHWYDRNKLSLKEIMNVQYISCMN 2592

  Fly  2666 PSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAIT 2730
            |:||||||:|||||||..||:..|..|||..|.::||:.|:  .:..|...:.|...:::..|:|
  Rat  2593 PTAGSFTINPRLQRHFSVFALCFPGADALSSIYSTILTHHL--KLGNFPTTLQKSIPSLINLAVT 2655

  Fly  2731 LHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDY 2795
            .|.|:.::||||||||||.|||||.||||.|:|:|::|...::..:::|::||..|||.||:|:.
  Rat  2656 FHQKIATTFLPTAIKFHYIFNLRDFANIFQGILFSSTECVKSTQDLVKLYLHESDRVYRDKMVEE 2720

  Fly  2796 TDINSFKKIVSDIVRKGIEGVNDDVVYAQ-PL---IYCHFAKGLTDIKYMPISGWDRLKSLLDEA 2856
            .|.|.|.|:.::.::|..:...|.:...| |.   :|||||.|:.:.||||:..||.|...|.||
  Rat  2721 KDFNLFDKLQTEFLKKNFDVTEDGIKLTQRPRSLNMYCHFANGIGEPKYMPVQSWDLLSQTLVEA 2785

  Fly  2857 QDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQI 2921
            .:.:|:....|:||||:||:.|:|.|:|||||.||.|||:||||||||||||||:||||:|||||
  Rat  2786 LESHNEVNAVMDLVLFEDAIHHICHINRILESPRGNALLVGVGGSGKQSLTRLAAFISSMDVFQI 2850

  Fly  2922 QLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEV 2986
            .|.|.|.:.|.|.::|:|.:|||||..:..|||||:.||.|:||||:|||||||:|.:|:.::|.
  Rat  2851 TLRKGYQIPDFKVDLASLCLKAGVKNLSTVFLMTDAHVADERFLVLINDLLASGEIPDLYSEEEE 2915

  Fly  2987 ENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTID 3051
            |||:|.||||||..|::|:||||||:|||:||..|||.|||||||..||:|||||||:||||.|:
  Rat  2916 ENIINNVRNEVKSQGLIDSRENCWKFFIERVRRQLKVTLCFSPVGNKLRIRSRKFPAIVNCTAIN 2980

  Fly  3052 WFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSF 3116
            |||||||:||||||||||.....:...:...:|.||||||.:||.||:.||.|.:||||||||||
  Rat  2981 WFHEWPQEALESVSLRFLQNTKNIEPAVKQSISKFMAFVHISVNKISQSYLINEQRYNYTTPKSF 3045

  Fly  3117 LELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLII 3181
            ||.|.||..||....|....:..||||||:||.|.:.:||.|:..|..|||||:.||::.|.||.
  Rat  3046 LEFIRLYQSLLERNGKELQSKVERLENGLLKLHSTSAQVDDLKAKLATQEVELRQKNEDTDKLIQ 3110

  Fly  3182 VVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTE 3246
            |||.|..|||:|:|.|.:||:.|..|..:|..|.|.||||..||:|||.|||.|||||||.||||
  Rat  3111 VVGVETSKVSREKAIADEEEQKVALIMLEVQQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTE 3175

  Fly  3247 LKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIK 3311
            ||||||||.||.:|..||:||.:..||:||||||||.:..|..||.|||:||::||::||.:.:|
  Rat  3176 LKSFGSPPLAVSNVSAAVMVLMAPGGKVPKDRSWKAAKITMTKVDSFLDSLIHFDKENIHENCLK 3240

  Fly  3312 ALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLT 3376
            |::||:.|..|:||.:..||.||||||||||||.|||:|:..||||.:||.::..::..|::||.
  Rat  3241 AIRPYLQDPAFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATSDLTAAQEKLA 3305

  Fly  3377 ALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVL 3441
            |:..::|.|.|.|..|..::::|.|:|.|||.||..||.||.:||||:||||:|.:||.|:|:..
  Rat  3306 AIKAKITHLNENLAKLTTKFEKATAEKLKCQQEAEVTAGTISLANRLVGGLASENVRWAEAVQNF 3370

  Fly  3442 TFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQ 3506
            ....:.|.||||:.:.||||:|.||:.||:.|.:..|.|.....:.|||:|..:||.:|:.|||.
  Rat  3371 RQQERTLCGDILLTTAFISYLGFFTKKYRKSLMDGTWKPYLSQLKVPIPTTPTLDPLKMLTDDAD 3435

  Fly  3507 IAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVE 3571
            :|.|.|:|||:||||.|||.||:..||:|||:|||||||||:|.|||..|.|.::.|:..|..:|
  Rat  3436 VATWQNEGLPADRMSMENATILINCERWPLMVDPQLQGIKWIKNKYGEELRVTQIGQKGCLQTIE 3500

  Fly  3572 RAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKP 3636
            ||:..|.|:||||:.|:|||||.|||||::||||..:||||:|.:||.:||||||||||||||:|
  Rat  3501 RALEAGDVVLIENLEESIDPVLGPLLGREVIKKGRFIKIGDKECEFNPKFRLILHTKLANPHYQP 3565

  Fly  3637 EMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSS 3701
            |:|||.||||||||||||||||||.||.:|.||||.:::.||:|||.||||||.|||:||:||||
  Rat  3566 ELQAQATLINFTVTRDGLEDQLLAAVVSMEIPDLEHLKSDLTKQQNGFKITLKTLEDNLLSRLSS 3630

  Fly  3702 AGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFK 3766
            |..|.|.:..||.|||.||:||.|::.||.|||:|.|:|:.|||.|||||.|||::|||:|||.|
  Rat  3631 ASGNFLGETALVENLEVTKQTAAEVQEKVQEAKLTEVKINEAREHYRPAAARASLLYFIMNDLSK 3695

  Fly  3767 INPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLC 3831
            |:|:||||||||::||..|:.||..:|.:|:||.||||||||..:.||:|||||.|||.:|.||.
  Rat  3696 IHPMYQFSLKAFSIVFQKAVEKAAPSEDVKERVTNLIDSITFSVYQYTTRGLFECDKLTYLAQLT 3760

  Fly  3832 IQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRW 3896
            .|||:...||...|||||||.|......|...:|:|..||.|:||::...|..|::|||||.|.|
  Rat  3761 FQILLVNQEVNAAELDFLLRAPVQAGTPSPMEFLSHQAWGSIKALSSMEEFCNLDRDIEGSAKSW 3825

  Fly  3897 KKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRT 3961
            ||||:||.||.||||.:||.|:.:||||:||.:|||||:||||.|:||||||||:..|.::|..:
  Rat  3826 KKFVESECPEKEKFPQDWKNKTGLQRLCMMRAMRPDRMTYAMRDFVEEKLGSKYVMGRPLDFVSS 3890

  Fly  3962 FEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGH 4026
            ||||.|.|.:||:||||||||||||..||.||::|::.|||:||||||||:|||.|:::|::.||
  Rat  3891 FEESGPATPMFFILSPGVDPLKDVENQGKKLGYTFNNRNFHNVSLGQGQEVVAEAALDLAAKKGH 3955

  Fly  4027 WVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPP 4091
            |||||||||||:||.:||||:|......|..:|:|:|||||..|..||:||||||::||||||||
  Rat  3956 WVILQNIHLVAKWLSTLEKKLEELSEESHPDFRVFISAEPAPSPEGHIIPQGILENSIKITNEPP 4020

  Fly  4092 TGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLT 4156
            |||.||:|||||||:.:||||||:|||||.|||:||||||||||||||||||||||||||.||||
  Rat  4021 TGMHANLHKALDNFTQDTLEMCSRETEFKTILFALCYFHAVVAERRKFGPQGWNRSYPFNTGDLT 4085

  Fly  4157 ISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG 4221
            |||.||||:|||||:||::|||||||||||||||||||||||||||||||::||:::|||....|
  Rat  4086 ISVNVLYNFLEANTKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIRPEMLEGELSLAPG 4150

  Fly  4222 FPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPR-MTGGSSGG 4285
            ||.||.:.|:|||.|||..||.|||.|||||.||||||||..||:|||.|.|:||| ...|...|
  Rat  4151 FPLPGNMDYSGYHQYIDAELPPESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDSQAGDGAG 4215

  Fly  4286 ETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELD 4350
            .|  :|:.:|..:|:|||:....|||.|||.:||:|:|||:||.|||||||.|..|::|||.||.
  Rat  4216 ST--REEKVKAFLEEILDRVTDEFNIPELMAKVEERTPYIVVALQECERMNILTREIQRSLRELH 4278

  Fly  4351 LGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPS 4415
            |||:||||::|.||:|...||:|.|||.|.:.||||..||.:||.||:.|::|||.|..||.|||
  Rat  4279 LGLQGELTMTSEMENLQNALYLDVVPEPWARRAYPSTAGLAAWFLDLLNRIKELETWTGDFVMPS 4343

  Fly  4416 SIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGAR 4480
            ::||.|||||||.||||||..|||||||||:|.|.||||||.:||..:.|||||||.|||||||.
  Rat  4344 TVWLTGFFNPQSFLTAIMQSMARKNEWPLDQMALQCDVTKKNREEFRSPPREGAYIYGLFMEGAC 4408

  Fly  4481 WDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERA 4545
            ||.:.|.||:|.||:|.|.|||:::||:..:|||.:::|.|||||...||||:|||||||::|..
  Rat  4409 WDTQAGIIAEAKLKDLTPPMPVMFLKAIPAEKQDCRSIYACPVYKTCQRGPTYVWTFNLKTKENP 4473

  Fly  4546 SKWTLAGVCLLLQ 4558
            |||.||||.||||
  Rat  4474 SKWVLAGVALLLQ 4486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 132/580 (23%)
DHC_N2 1368..1770 CDD:285579 219/407 (54%)
P-loop_NTPase 1903..2132 CDD:304359 203/229 (89%)
P-loop_NTPase 2217..2352 CDD:304359 104/135 (77%)
P-loop_NTPase 2510..2783 CDD:304359 151/273 (55%)
P-loop_NTPase 2860..3127 CDD:304359 172/267 (64%)
MT 3140..3480 CDD:289543 182/340 (54%)
AAA_9 3509..3722 CDD:289547 141/213 (66%)
Dynein_heavy 3864..4549 CDD:281078 451/686 (66%)
Dnah9XP_002724553.1 DHC_N1 210..787 CDD:285571 134/593 (23%)
DHC_N2 1293..1697 CDD:285579 219/407 (54%)
P-loop_NTPase 1830..2060 CDD:304359 204/230 (89%)
P-loop_NTPase 2144..2279 CDD:304359 104/135 (77%)
P-loop_NTPase 2437..2708 CDD:304359 151/273 (55%)
P-loop_NTPase 2789..3056 CDD:304359 172/267 (64%)
MT 3068..3411 CDD:289543 183/343 (53%)
AAA_9 3438..3651 CDD:289547 141/213 (66%)
Dynein_heavy 3788..4477 CDD:281078 452/691 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355002124
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.