DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah6

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017448573.1 Gene:Dnah6 RGDID:621797 Length:4147 Species:Rattus norvegicus

Alignment Length:4468 Identity:1362/4469 (30%)
Similarity:2213/4469 (50%) Gaps:665/4469 (15%)


  Fly   432 LEEL-KDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYRE----WTNIQYNPIDPDA 491
            :|.| ||.|.....||..|..:  .||..:.......:|...|.|..:    :.:::.|  :|:.
  Rat     1 MESLRKDGFRIRMAFQGTENEI--DLKSMENQEEENPVLTRLNKIRAKGVLNYASLKEN--EPEP 61

  Fly   492 ENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLLRPIIK---KHVEPLMHVIVD 553
            :..:|   |.:.||:....:|....:.|.                .|::|   .|.:|  ..|.:
  Rat    62 QTLVF---RHTTKAQEKTRKRQQPVKLEP----------------LPVLKLYQDHKQP--EYIYE 105

  Fly   554 DFEEEIM----------CVKKEFINFKNVFTALGLNEL--PTDDCF-------PKVSGAISFLKK 599
            ...:::|          .:::..|.......||...::  |:.|.|       |:.|.....|..
  Rat   106 QNRQQLMSTGILKPSPSMIERSSIGSLEAQEALKRKQVLRPSADVFSLSPSKLPRTSIGRRGLFG 170

  Fly   600 LRH-----------------------RIIGLHKEHE----LYEYPLFDNERGGYVSDIFNIMVQE 637
            :|.                       :||.:..|:|    ||..|........|  |.:|:.|..
  Rat   171 MRSSTYPKYTFNDREEVVKANIRDPLQIIKIVHENEHLGFLYMIPAVPKSSIEY--DTYNLKVVS 233

  Fly   638 IDDFTKMLLDKWTVE---CWQGIQQDITLTLIEKDEANEL-RVNFTERLIFAL-----------K 687
            .::..|.  |.:|:.   .......||.....|:.|...| ....|:..||:|           |
  Rat   234 YENINKN--DYYTISKDAVTHVFNDDIEYIETERWEQEYLYHRELTKIPIFSLFRKWKAFSVWRK 296

  Fly   688 DIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEW-YNDTF------ERAHP-TEKRLIAA 744
            :::..::.||..::....|....    ..|..|::|.:. |..:|      |:.|. |.:...||
  Rat   297 NVRSKKITGCRKALRKNLFIVNP----YLRPALLKINDMCYQLSFMGLCYIEKFHTYTLQEFKAA 357

  Fly   745 EMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQR 809
            :::.::|..:.|..|        ||                   |..:.:::|.|          
  Rat   358 QVVRVQEVTERLEYF--------RF-------------------EAKDVVRKSCR---------- 385

  Fly   810 KDLNPALLLHTDPREPILSIRAANAADTQRLIDL---LMYVNLKLFFDIPRRYSLPPGEHGEED- 870
                             .::|||........::.   ...:|:..|.|.|.  .||  .:||.: 
  Rat   386 -----------------FALRAAGFIPDDCEVETHEDYFKINIASFIDAPS--DLP--TYGESEK 429

  Fly   871 ----EESDG-----------------IWPPIISLSVMT--------SVKFKK--KREVIDE---E 901
                |::..                 |...:..|:|.|        |.|.|:  ..:||.:   |
  Rat   430 MTYTEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTASSLLNYLSDKLKRTPSADVIQKWITE 494

  Fly   902 DDLEEFEEE-----QSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITS 961
            |..|..|::     :.:.|:|.:.|....||:..:   :..||        |...|:.:|.:   
  Rat   495 DKPEVIEKKGAPMMEKQEEDESLIPMFLTELILTV---QSLLF--------EPSLEDFLDGI--- 545

  Fly   962 STYLRMEVDNRYENNTPIFEIFMELQEPNVV---YFR-------NLDTSSKT-GFAFFIETILDD 1015
                 ..:.|.:||..        |..||:|   ||.       |.....|| |....:..:.:|
  Rat   546 -----SGIINHFENTV--------LSVPNLVPDSYFNAFTSPFINKKVEEKTCGPGPSLSAVFED 597

  Fly  1016 MNNMMSLLKRVAQDPTEVTNMNPYSFYDELQ-DKSELDKQRVEIMNKIKLALQAVRVHGKGFMEF 1079
            ..|.:::::::.:        ..:|.:|..: ..:..:|.::.......|.|:|::........|
  Rat   598 DRNFLTIIQQIKE--------TIHSAFDSARLYAATFEKFQIFFKENESLDLEALKEEEPDVEFF 654

  Fly  1080 SS-LWIWDKSTYLSEVKKFGRN---LTLDERDAEADLEGS--SGVKLLGLEYPPLSVYKEQLDKF 1138
            || |..:.|....|...|..||   |.:|.:..:..|..|  ..:::|.|..|.||  |:::|..
  Rat   655 SSQLEKYHKQHKDSVALKPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNLMLPRLS--KKKVDAI 717

  Fly  1139 I----------------------------ELQDQIRTWETY--------------------EDFF 1155
            |                            |:|::|.|.|..                    |||.
  Rat   718 ISEAQDAEYKLEFVPTTTIEYVNSLVFLDEIQERIETLEEEGNTVVQMYKLIEQYQVLTPPEDFA 782

  Fly  1156 VF--LRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGL 1218
            ||  ::.::|..:.|:...||        |..:.:|.....|...:::.|               
  Rat   783 VFATMKPSITAVRNAIDKSVG--------DRESSIKQFCLHLGRDLEDLN--------------- 824

  Fly  1219 VKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQ 1283
                   |::||               :.||.|      |.::..|:..|:   |:       |.
  Rat   825 -------NEVNE---------------VKLLAQ------DPQILDISADPE---KI-------KT 851

  Fly  1284 LIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSL 1348
            :::.:||. :|.::||..    ...:|:|.|                                  
  Rat   852 MLSDLQSV-LDDLQKRAF----QYKSYQKNF---------------------------------- 877

  Fly  1349 AESAVLFELQGPDPVKIELCRFD--------LKLVKIMWDFAITIQSTINDWKKTPWKKIDIENM 1405
                           |:|:.:||        |:|.:::||..........:|.|:.:..:|.|.:
  Rat   878 ---------------KVEVSKFDALEEVCAELRLKQLLWDSLSEWDKLQQEWLKSKFDCLDPEVL 927

  Fly  1406 DQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTT-KVK 1469
            :.:..|:.:.:..|:|.:........::..::.:...|..:.:|:||.::.|||..:.||. .:.
  Rat   928 NGQVTKYAKFVTQLEKGLPPNSVVPQLKQKVERMKEKLPVINDLRNPTLKPRHWSAIEQTVDALL 992

  Fly  1470 FSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIH-DRTSIK 1533
            ..::...||:.|.:|::.::.:|:::|..::..|.|:|..|:.:..:|.|.||....| |...:.
  Rat   993 VDIEIPLTLERLSELHVFDFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVF 1057

  Fly  1534 LLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESI 1598
            :|..::::...|:|....:..:|||:|:...:..|..||.:||..:|.:..|...||.|.|||||
  Rat  1058 ILGGTDDIQVLLDDSTINVATIASSRYVGPLKTRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESI 1122

  Fly  1599 FIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG-SKLYEHLEILLKMLLLCE 1662
            | .:.||:.|||.:::.|..:||.:|.::.::|...|.:|:..:.| .:.:::...||..:   :
  Rat  1123 F-NAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQI---Q 1183

  Fly  1663 KALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL---------IS 1718
            |.|..|||:||:.:|||||:|:.:||:||:...||..|..||.|.:||:.||..         |.
  Rat  1184 KCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIP 1248

  Fly  1719 G---------SKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYD 1774
            |         :.:...|::.| .|.|...:.....|.||.||.::.:.|..:||...|.::..|.
  Rat  1249 GIDTEPEKVFTNDILAMLSPE-GERVGLGKGLKARGNVEEWLGKVEEAMFSSLRRLCKAAIADYQ 1312

  Fly  1775 HKPRHVWIFE-WPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGD 1838
            .|.|..|:.. .|:|..|..:||||..:..::. :.:..:..||:.:.:....:||.|..::.|.
  Rat  1313 GKLRTEWVIAGHPSQVILTISQIMWCRDLTESL-ECEDNHLEALEKFEQVNFERLNALAAIVRGS 1376

  Fly  1839 LTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRY 1903
            |....|..|..:.|||||:||:|..::..||:...:|.||.|||:.||..:|:|.|.:..:|:.|
  Rat  1377 LPKLHRNIITALITIDVHARDIVSELVQSKVDSAESFDWQRQLRYYWDVDLDNCVARMALSQYTY 1441

  Fly  1904 DYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCS 1968
            .|||||..|||||||||||||:.|..:|.|.:|||||||||||||||||||.:||.:...|||||
  Rat  1442 AYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCS 1506

  Fly  1969 EQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIAL 2033
            :.:|||.:|....||||:|||.||||||||.:|||||:|.|:..|::|..:|...|.|.|..|.|
  Rat  1507 DGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKL 1571

  Fly  2034 RTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLY 2098
            ..|...|||||||||||.|||:|||||:||.||:||::|||:|::.|:.||:.:::||||...:|
  Rat  1572 VMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVISVSVGFESSKILARKMTQMY 1636

  Fly  2099 TLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMG 2163
            .||.|.||:|||||:|:||:|||||:||:|:|::....||.||:|||||.|:||.:|||..:|.|
  Rat  1637 KLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSG 1701

  Fly  2164 LIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGK 2228
            :|.||||.:.:|........:.|....:...||||...:.|::||.|...|||.|.::|..|.||
  Rat  1702 IISDLFPGVQIPEHDYGILHSTIVDVMISQNLQPEICMVKKVIQLYETMLVRHGVMLVGPTGGGK 1766

  Fly  2229 SEVWKTLNKTYQNQKR----KPHYND-----LNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQ 2284
            :.|::.|.:|..|.::    .|.|..     ||||::|..||:|.||..|.||||||.::.:|..
  Rat  1767 TTVYQVLAETLGNLEKLNTGNPFYQPVKTFVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAA 1831

  Fly  2285 ANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPAT 2349
            .|......|||:.||.:|.:|||::|||:||||:|.||::|||.||.::.:|||:..|:.|:|||
  Rat  1832 VNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQVHMLFEVQDLKVASPAT 1896

  Fly  2350 VSRAGILYINPQDLGWTPFIQSWLGTRTN--SSEVS--MLNVLFDKYVPPLLDIFRTRLRSITPI 2410
            |||.|:::::|::|.|.|::::|:.|.:.  |.|:.  :|| ||::||...|.....:.....|.
  Rat  1897 VSRCGMVFVDPEELKWMPYVKTWMSTLSKKLSEEIREYLLN-LFNRYVDDGLRFVNKKCTQAIPQ 1960

  Fly  2411 SDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEI------YFVFCIVWGFGSSLFQDQIIDWS--N 2467
            .||:::...|.||:|:|..:: .|....:..::      .||||.:|..|.:|.::.   |.  :
  Rat  1961 VDISKVTTLCCLLESLLLSKD-GNILSLEQMKLNTVVCQTFVFCYLWSLGGNLTENH---WDSFD 2021

  Fly  2468 EFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLR 2532
            .|.:...::....:.|.||.::|.::|.:||:..||..::|.|:...::|....||.||:|.|..
  Rat  2022 TFIRTQFDDNPDARLPSSGDLWSIHVDFDTKRLDPWERIIPTFKYSREVPFFEMLVPTADTVRYG 2086

  Fly  2533 FFMDTLIEADHPLMLIGPSGSGKTILMNAKLSAL-PSDKYSVTNVPFNFYTTSEMLQRILEKPLE 2596
            :.|:.|:...|.::..|.:|.||:::....|:.: .|..|....:.|:..|:|...|.|:|..||
  Rat  2087 YLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSARTQEIIESKLE 2151

  Fly  2597 KKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIV 2661
            :|.....|..|||:::.||||:|||.:|:|.:..|..|:||:.|:..:|||.|:..::|....||
  Rat  2152 RKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIV 2216

  Fly  2662 -ACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMV 2725
             ||..|..|...:.||..|||....:..||:.:|..|..:||:..:.:    |.:||.:...|:|
  Rat  2217 SACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLAD----FTEAVKQTSSNIV 2277

  Fly  2726 TTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGD 2790
            ..|:.::.::....|||..|.||.|||||::....|:|..:..|.....|:.||:.|||.||:.|
  Rat  2278 EAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEMQIFRLFCHECQRVFHD 2342

  Fly  2791 KLVDYTDINSFKKIVSDIVRKGIEGVNDDVVY--AQPLIYCHFAK---GLTDIKYMPISGWDRLK 2850
            :|::..|.:.|..|::::..|.. |:..|:.|  ::|:|:..|.|   ...|..|..:...::::
  Rat  2343 RLINNEDKHYFHVILTEMANKHF-GIAIDLEYFLSKPIIFGDFIKFGADKADRIYDDLPDIEKIE 2406

  Fly  2851 SLLDEAQDRYN-DYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFIS 2914
            ::|.:..|.|| .....:.||.|.||:.||.||:|::...||.|||:||||:|||||||||:.|.
  Rat  2407 NVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHIC 2471

  Fly  2915 SLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHE 2979
            .....||:|::.|:......::..||..|||:.....||.||:::..|:||..:|::|.||::..
  Rat  2472 GYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPN 2536

  Fly  2980 LFPDDEVENIVNAVRNEVKQLGIVD-NRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPA 3043
            ||..||:|.::.|.|.:.|::||.: ||:..::|||.:||..|.:|||.||||...|.|.|.||:
  Rat  2537 LFEKDELEQVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPS 2601

  Fly  3044 LVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRY 3108
            ||||.|||||.:||::||.|||..|.|.:....:||...:|.....||.:|:.::..|.:..:|.
  Rat  2602 LVNCCTIDWFVQWPREALLSVSKSFFSVVDTGNEELKEKLSLMCVNVHLSVSHMADRYYSELRRR 2666

  Fly  3109 NYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVD-------ALQDVL--KV 3164
            .||||.|:||||.||..:|.||.|..:..|.|:.|||.||......||       ||:.||  |.
  Rat  2667 YYTTPTSYLELINLYLTMLTEKRKQLVSARDRVTNGLTKLLETNILVDKMKLDLSALEPVLFQKS 2731

  Fly  3165 QEVE-----LKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLK 3224
            |:||     |.:..:.||.:..|| .|:|.::|.:|             |:..|.|...:.|..:
  Rat  2732 QDVEALMEKLVVDQESADQVRNVV-QEDEAIAKVKA-------------EETQAIADDAQRDLEE 2782

  Fly  3225 AQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGN 3289
            |.|||.||.:||::|:|.:::|::.|..|||.|::|..|:.:|.::|      ..|...:..:|:
  Rat  2783 ALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAK------PDWPTAKQLLGD 2841

  Fly  3290 VDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVV 3354
             ..||..|:.|||::|.|.::..||.||.:.:|.|||:...|.|...:|.||..::.:..|...|
  Rat  2842 -SNFLRRLLEYDKENIKPQILSKLQRYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEV 2905

  Fly  3355 EPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDI 3419
            |||.:.|..::.|:......|......|.::|||:.|||.|||:.:.:|:......:.|...:..
  Rat  2906 EPKRQKLRAAQAELDATITTLKEKQALLKQVEEQIRALQEEYDKGVNEKESLAKTMALTKARLVR 2970

  Fly  3420 ANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKN 3484
            |.:|...|..|::||.||::.....|..:.|::.|.:..::|.|.||..|||.|.| .|:.:...
  Rat  2971 AGKLTAALGDEQVRWEESIEKFQEEIANIVGNVFIAAACVAYYGAFTAQYRQLLIE-CWIDSCLA 3034

  Fly  3485 SQPPI-PSTDGV----DPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQG 3544
            ...|| ||...:    ||:|       |.:||..|||.|.:|.||..::.|..|:|||||||.|.
  Rat  3035 LDIPIDPSFSLINTLGDPYE-------IRQWNADGLPRDLISTENGILVTQGRRWPLMIDPQDQA 3092

  Fly  3545 IKWVKTKYG-TGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--T 3606
            .:|::.|.. :||.|::|:..|:|..:|.::..|..:|:|.:.|.:||.|.|:|.:|....|  .
  Rat  3093 NRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRL 3157

  Fly  3607 VLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLE 3671
            ::::||.:||::..||..:.||:.||||.||:..:.|:||||||:.|||||||::||::|:|:||
  Rat  3158 LIRLGDSDIDYDKSFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELE 3222

  Fly  3672 AMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKIT 3736
            ..|.:|..:.|..|..||.:||.:|..|.::..|:|::..|:..|:.:|.|:..|:.::.||:.|
  Rat  3223 GQRVQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAEST 3287

  Fly  3737 GVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVEN 3801
            .:.|:.|||.|||.|.:.|::||::..|.:|:|:||:|||.|..:||..:..:..::.|::|:..
  Rat  3288 ELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDSLQERLAI 3352

  Fly  3802 LIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR--------FPYMPNQ 3858
            |:......::...|||||||.|||:...||:.|:....::...|.:|.||        .|..|..
  Rat  3353 LLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMRQQEQLTEAEWNFFLRGSAGMEKERPPKPEA 3417

  Fly  3859 TSNFTWLTHVGWGGIRALNNQ-AVFKGLEKDI--------EGSHKRWKKFVDSESPENEKFPGE- 3913
                .||....|.....|... .:|:||.:.|        .||   ::.:::.:|.|.  :|.: 
  Rat  3418 ----PWLPIQMWFSCCDLEEWFPIFEGLTRHILLHPISISLGS---FETYINPQSWEG--YPKQR 3473

  Fly  3914 --------WKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPET 3969
                    |... |:..:|.:::|.:.:::.:|:..|:.|.||.::|:...::.:..:::.|..|
  Rat  3474 HEEEKEHVWGSNFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSSST 3538

  Fly  3970 HIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIH 4034
            .:.|:||.|.||:...::..:..|::   |...|:||||||..:||..|:.|::.|:||.|||.|
  Rat  3539 PLVFILSTGSDPMGAFQRFARESGYA---ERVQSISLGQGQGPIAEKMIKDATKSGNWVFLQNCH 3600

  Fly  4035 LVARWLPSLE---KKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMA 4096
            |...|:.::|   |.......::..::|||||:.|.              |...:|||||.|:.|
  Rat  3601 LAVSWMLAMEELIKTFTDPNQSIKDTFRLFLSSMPC--------------STFLVTNEPPKGLRA 3651

  Fly  4097 NIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYV 4161
            ||.:|....:....|......:::.::|.:|:|||::.||:||||.|||..|.||..|...::..
  Rat  3652 NIRRAFTEMTPSFFEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLN 3716

  Fly  4162 LYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG--FPA 4224
            |..|.... ::||:.|.|:.|||.|||.:||.||:|..||.|:.|..||.::.|..|.:.  :.|
  Rat  3717 LNLYCHEG-KIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLEDEYTYSESGIYFA 3780

  Fly  4225 PGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVS 4289
            |.......:.:||:|....:.|.::|:|.||.:.|....:..|...:.|:|||   .|||||..|
  Rat  3781 PLADSLQEFKDYIEDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPR---SSSGGEGKS 3842

  Fly  4290 QEDIIKNIIEDILDKTPTPFN---------ILELMGRVEDRSPYIIVAFQECERMNNLMTELKRS 4345
            .::|::.::..|..:.|....         :.:..||:...:   .|..||.:|.|||:..:..|
  Rat  3843 NDEIVQELVASIRTRVPESLQMEGASETLFVKDPQGRLNSLT---TVLGQEVDRFNNLLKLIHIS 3904

  Fly  4346 LNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVAD 4410
            |..|:..:.|.:.:|..||.:......:|||..|:..||||:..|.||..||:||...::.|:..
  Rat  3905 LETLNKAIAGLVVMSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGSWVKDLILRTAFVDLWLKR 3969

  Fly  4411 FRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKE---------------- 4459
             ..|.|.|::|||.||..||..:|..|||...|:|.:....::...:::                
  Rat  3970 -GQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIPVYRDQALVIEAAKDIQFGTE 4033

  Fly  4460 -----ELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVY 4519
                 ||.| |.:|..::|:||:.:|||.|...|.||...::.|.:||::.:. .|:.:.|:.:|
  Rat  4034 LPMDKELPT-PEDGVLVHGMFMDASRWDDKDMIIEDALPGQMNPMLPVVHFEP-QQNYEPIQTLY 4096

  Fly  4520 ECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
            ..|:||...|..|         ||.|..|.|:..:..|...|..||.|
  Rat  4097 HSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRPSDYWIAKGSALLCQ 4144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 77/408 (19%)
DHC_N2 1368..1770 CDD:285579 118/431 (27%)
P-loop_NTPase 1903..2132 CDD:304359 142/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 64/144 (44%)
P-loop_NTPase 2510..2783 CDD:304359 91/275 (33%)
P-loop_NTPase 2860..3127 CDD:304359 118/269 (44%)
MT 3140..3480 CDD:289543 113/354 (32%)
AAA_9 3509..3722 CDD:289547 88/216 (41%)
Dynein_heavy 3864..4549 CDD:281078 221/748 (30%)
Dnah6XP_017448573.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.