DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah3

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_008772869.1 Gene:Dnah3 RGDID:1305855 Length:4069 Species:Rattus norvegicus

Alignment Length:4171 Identity:1273/4172 (31%)
Similarity:2033/4172 (49%) Gaps:535/4172 (13%)


  Fly   785 VAAQENLEAIKESIRSWG-KVPLFQRKDLNPALLL-----HTDPREPILSIRAANAADTQRLIDL 843
            |:|.|....|.:::.|.. ..||.||.....|:..     |..|.:.|.:..:..|.| .:|.||
  Rat    34 VSANEEPSEIYKTVMSHSFYPPLMQRTSWTLAVPFKEQDQHRGPSDSIGNNYSLTARD-MKLKDL 97

  Fly   844 LMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDL---- 904
            :. |...:...:||            |:.|.|:  |:.| ...|....||.:..|..:||.    
  Rat    98 VK-VYQPVTISVPR------------DKASQGL--PLAS-KTSTEPSKKKMKLCIKGKDDATGTP 146

  Fly   905 --------------------------------------EEFEEEQSESE-EEIITPFHRYELLKG 930
                                                  :|.|.|..|:: .|:....:.|.|..|
  Rat   147 LACKHSSSSNMKNATDSSLTYPESRPMSPEQQMDVMLQQEMEVESKENKPSELDLERYYYYLTNG 211

  Fly   931 L------SQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEP 989
            :      .::|..:.|.|::         :..:::|:.....::|..|.|..:..:...|:    
  Rat   212 IRKDMIAPEDEDVMVRIYKL---------IPKTLLTTPALEPLQVSLRSEKESDYYYSLMK---- 263

  Fly   990 NVVYFRNLDTSSKTGFAFFIETI-----------------------------LDDMNNMMSLLK- 1024
            ::|.:..:|...|.  ..||::|                             |..:|.||..|| 
  Rat   264 SIVDYILMDPLEKK--RLFIKSIPRLFPHRVIRAPVPWHNIYQSVKKWNEEHLHTVNPMMYTLKE 326

  Fly  1025 ------------RVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFM 1077
                        |.|........:.|:.:.:|:| |..||.::|.:...|....|......:.::
  Rat   327 LWFSEFKDLRFIRTADLLAGKLPLLPHEYQEEIQ-KHCLDARQVLLSKWIPTCAQLFVTQKERWV 390

  Fly  1078 EFSSLWIWDKS----TYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYK------ 1132
            .|:....:|.|    .|.:.|..|   ::|..|:..        :|.||.......::|      
  Rat   391 HFAPKNDYDSSRNIEEYFASVASF---MSLQLRELV--------IKSLGDLVSFFMIHKDGNDFN 444

  Fly  1133 ---EQLDKFI--------ELQDQI--------RTWETYEDFFVFLRLNMTGF-KV---------- 1167
               :::|.||        |:.|.:        ..|:..::.|:.:..|..|. ||          
  Rat   445 EPYQEMDFFIPQLITIKLEVDDPVIVFNPTFDDCWQLIKESFLEIIKNSNGIPKVESILFPDLKG 509

  Fly  1168 -------------AVLSQVGQWISLFKLDLI--NRVKNSLKELQDFVD-----EANIVLKIELQK 1212
                         .|...:.|.:.:|..:.:  ::..|..|:..|.:|     :.:..|..:...
  Rat   510 YNMILGTVDPEENLVADFLNQTLEVFNKNQVGPHKYLNVYKKYDDLLDNTAEQDISTFLNDKHDI 574

  Fly  1213 DDFEGLVKILSVLNQINEKQCIYD----SMF------------DPLKEIIDLLRQYNYEF-KDTE 1260
            |||  :..|.|:..:.||...::.    :||            :..:.:.|.|.||..:. ::|.
  Rat   575 DDF--VTSINSIKKRRNEIASMHITVPLAMFCLDAVLLNHDLCERAQNLKDRLIQYQVDVNRETN 637

  Fly  1261 LAQINELPDAWMKVKRLAATTKQLIAPIQSYQ---------------------------VDLIEK 1298
            .:..|:......||....|.|.:|:|.|:..:                           .||..:
  Rat   638 TSICNQYSTIADKVSETPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPNE 702

  Fly  1299 RILLCDNM----------ANTYRKKFLSKKFFFVPCLSCYELIDESDLELV-------------- 1339
            .|.|..|:          ....|...|||:             |:::::|:              
  Rat   703 DIKLNSNLFLWPDQIEDVFENSRNLLLSKR-------------DQAEMDLIKRCSEFETRLEGYS 754

  Fly  1340 ----------------------ALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKI----- 1377
                                  .|.:..::|..:...|||...:...:|..:....|:::     
  Rat   755 KELEMFRKREVMTTEEMKNNVEKLNDLSKNLDLALTEFELINKEEELLEKEKSSFPLLQVLMVNK 819

  Fly  1378 -----MWDFAITIQSTINDWKKTPWKKI-------DIENMDQECKKFGRELRGLDKAMRTWEPFI 1430
                 :|..|....:...:|...|...:       ||.||.:...|..:.|..:....|..|.  
  Rat   820 IPYEQLWVTAYEFSTKSEEWMNGPLFLLNAEEIAEDIGNMWRTTYKLTKTLIDVPAPRRLAEN-- 882

  Fly  1431 FMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKN 1495
             ::..::.....:..:|...||.::||||.::......:....::|.|.::::....::.::::.
  Rat   883 -VKLKIEKFRQHIPVLTIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEFGFSKFVDKLEP 946

  Fly  1496 IVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKY 1560
            |...:.||.::||.|..:.:.|..|.|....:..|...:|.|.:::...|:||..:.|.|..|.:
  Rat   947 IGAAASKEYSLEKNLEKMKSDWVNMCFSFVKYRDTDTSILCAVDDIQLLLDDHVIKTQTMCGSVF 1011

  Fly  1561 IAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKA 1625
            |...|.|.|.|:.:|....:.:.:|.:.|..|.|||.|| .||||.:|:||:.::|..:|..:|:
  Rat  1012 IKPIEAECRKWEEKLVRVQENLDAWLKCQATWLYLEPIF-SSEDIIAQMPEEGKKFGIVDSYWKS 1075

  Fly  1626 LLAQMNADRNVVRSTN--RSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLL 1688
            |:||...|..|:.:.:  |...||.| ..:||:.:   ::.||||||.|||.:|||:|:|:.:||
  Rat  1076 LMAQAVNDTRVLVAADQPRMTEKLQE-ANVLLEDI---QRGLNDYLEKKRLFFPRFFFLSNDELL 1136

  Fly  1689 DILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLEN---CDCSGKVEVW 1750
            :|||...:|..|..||.|.::.:.||. .:.:....||::.| :|.|||::.   ....|.||.|
  Rat  1137 EILSETKDPLRVQPHLKKCFEGIAKLE-FTDNLEIKGMISSE-KEIVPFIQTIYPVKAKGMVEKW 1199

  Fly  1751 LNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYEN 1815
            |.::...|..::|..::..:..|...||:.|:.:||.|..:..:.|.||.|.::|..      |.
  Rat  1200 LQQVEQVMVASMRQVIEDGIEAYLKVPRNAWVLQWPGQVVICVSSIFWTREVSEALV------EY 1258

  Fly  1816 ALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQ 1880
            .|.|:.||...|:..::.|:.|.|::..|..:..:..||||:||||..:....:.....|||.||
  Rat  1259 TLTDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLEQDNINSLNDFQWISQ 1323

  Fly  1881 LRHRW-DPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAG 1944
            ||:.| :..:.   ..:...|..|.||||||:|||||||||||||.||..:|.|.:||||.||||
  Rat  1324 LRYYWVESNVQ---VQMITTQALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAG 1385

  Fly  1945 TGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQ 2009
            ||||||||||.:||.....|||||:.:|||::|...|||||.|||.||||||||.||||||||.|
  Rat  1386 TGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQ 1450

  Fly  2010 VKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALI 2074
            :..||.||..|.:.|.|.|..::|..|..||||||||||||||||:|||||:|..||:|||:|||
  Rat  1451 ILSIQQAIIRKLKMFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALI 1515

  Fly  2075 SEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQ 2139
            .||.|.:.||.::|.||:|.:..|.||.|.||.|.|||:|:||:||||..||.|:....:..|..
  Rat  1516 GEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESV 1580

  Fly  2140 VLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEA---VIKRSALDLKLQPEDGF 2201
            :|:|||.|.|:.|.:..|||:|.|:|.||||.:.:|:   |::|.   .:..:..::||||...|
  Rat  1581 LLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPK---PDYEVFLEALNNNIRNMKLQPVPWF 1642

  Fly  2202 ILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKT-------LNKTYQNQKRKPHYNDLNPKAVTND 2259
            |.||:|:.|:..|||...|:|....||:..:|.       |:...|.::....:..:||||:|..
  Rat  1643 IGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMG 1707

  Fly  2260 ELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASN 2324
            :|:|..:..:.||.||:.:...|:||:......|||:.||.:|.:|||::|||:||||.|.|.|.
  Rat  1708 QLYGYFDAVSHEWTDGVLANAFREQASSVTDERKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSG 1772

  Fly  2325 ERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTR---TNSSEVSMLN 2386
            |.|.::.:|.|:||.|.|..|:||||||.|::|:.|..|||.|...|::.|.   .|.....::.
  Rat  1773 EIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMDTLPPCLNKEHTELVE 1837

  Fly  2387 VLFDKYVPPLLDIFRTRLRSITPISDI----ARLQMTCYLLDSMLTPQNVPNDCPKD-------- 2439
            .:|...|.|.||..|...:.:...|.|    :.:::...|||.:...|....:..:.        
  Rat  1838 DMFTWLVQPCLDFNRLHSKFVVQTSPIHLAFSMMRLYSSLLDELWAIQEEEMEIYEGLSSQQIFL 1902

  Fly  2440 WYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLN----------EYKAVK------FPLSGTI 2488
            |.:..|:|.:||....::..:.    ..:|..:|.|          ..|:||      ||..|:|
  Rat  1903 WLQGLFLFSLVWTVAGTINAES----RKKFDVFFRNLIMGMDDHNPRPKSVKLTKNNIFPERGSI 1963

  Fly  2489 FSFY-IDHETKKFFPWTNLVPQFE--LDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGP 2550
            :.|| :......:..||..:.:.|  :..:..:...::.|.||.|..||:.|.::.:.|::.:||
  Rat  1964 YDFYFLKQGGGHWNAWTEYITKEEETIPANAKVSDLIIPTMETARQTFFLKTYLDHEIPILFVGP 2028

  Fly  2551 SGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFV 2615
            :|:||:.:.|..|..||.:.|....:.|:..|::...|.|:...|:::....:||...|:.:.||
  Rat  2029 TGTGKSAITNNFLLHLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFV 2093

  Fly  2616 DDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPRLQR 2679
            ||:|||..:.|....|..|:||::|:.:|:|::.....||....:|..|.|..|... |..|..|
  Rat  2094 DDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTR 2158

  Fly  2680 HFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAI 2744
            |....::|....:.|..|.:||...|..   :.||...::....:|.....::...|.:||||..
  Rat  2159 HLNLLSINAFEDEILTKIFSSIADWHFG---KGFDVMFLRYGRMLVQATQIIYRAAVENFLPTPS 2220

  Fly  2745 KFHYNFNLRDIANIFTGVLYSNSETCPNSN-----QMIRLWIHECYRVYGDKLVDYTDINSF--- 2801
            |.||.|||||.:.:..|||     .||:::     :.|||||||.|||:.|:|:|..|..:|   
  Rat  2221 KSHYVFNLRDFSRVIQGVL-----LCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTFFNL 2280

  Fly  2802 -KKIVSDIVRKGIEGVNDDVVYAQP-----------LIYCHFAKGLTDIK-YMPISGWDRLKSLL 2853
             |:..|:..::.:|.|   :::..|           |.:..|.|..:|.| |..|.....|..::
  Rat  2281 VKETTSNCFKQTVEKV---LIHLSPTGKITDENIRSLFFGDFLKPESDQKIYDEIIDLRNLTVVM 2342

  Fly  2854 DEAQDRYNDYIGA-MNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLD 2917
            :...|.:|....| |:||:|..|:.|:.||.|:|:.::|:.||:|:||||:||.|:|::|::|.:
  Rat  2343 EYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQNKGHLLLVGIGGSGRQSATKLSTFMNSYE 2407

  Fly  2918 VFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFP 2982
            ::||::||:|:.:|.:.::..:.:::||.|.:..||..|:::..|.|:..:|.||.:||:..:||
  Rat  2408 LYQIEITKNYTGNDWREDLKKIMLQSGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFP 2472

  Fly  2983 DDE----VENIVNAVRN-----EVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRS 3038
            .||    ||.:..|.|.     ||..|.:       :.:|||:||..|.:||..||:|...|.|.
  Rat  2473 ADEKADLVEKMQTAARTGGEKIEVTPLSM-------YNFFIERVRKNLHIVLAMSPIGDAFRTRL 2530

  Fly  3039 RKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLA 3103
            |.||:|:||.|||||..||..|||.|:.:||.::. |...:...|.:...:..::...:|..|..
  Rat  2531 RMFPSLINCCTIDWFQSWPTDALELVANKFLEDVE-LDDNIRAEVVSMCKYFQESAKKLSVDYYN 2594

  Fly  3104 NAKRYNYTTPKSFLELIALYSKLLHEKVKANLD-RRLRLENGLIKLASCTKEVDALQDVLKVQEV 3167
            ...|:||.||.|:||||..:..||:.| :..:| .|.|...||.||...:.:|..:|..|...:.
  Rat  2595 TLLRHNYVTPTSYLELILTFKTLLNSK-RHEVDLMRNRYLAGLQKLEFASSQVAVMQVELTALQP 2658

  Fly  3168 ELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAA 3232
            :|...::....:::.:..|.::...::.....:||..........|....||.|..:|.|||.||
  Rat  2659 QLIQTSENTAMMMVKIEMETKEADAKKLLVQADEKEANAAAAVAQAIKNECEGDLAEAMPALEAA 2723

  Fly  3233 QEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLF----------SSKGKIPKDRSWKACRAFM 3287
            ..||:|||..::|.:||..:||..|..|..::.|:.          |..||:.:| .|...|..:
  Rat  2724 LAALDTLNPADITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIED-YWGVSRKIL 2787

  Fly  3288 GNVDKFLDNLINYDKKHIHPDVIKALQPYILD-AEFSPEKILAKSSAAAGLCSWVININRFYDVY 3351
            |:: |||::|..|||.:|.|.::|.::...:| .:|.|..|...|||..|||.||..:..:..|.
  Rat  2788 GDL-KFLESLKTYDKDNISPVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVA 2851

  Fly  3352 LVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFT 3416
            .||.||...|.|:|.:::....||......|..:|::|.||..|::...:||...::.....:..
  Rat  2852 KVVAPKRERLREAEGKLEIQMHKLNQKRAELKLVEDRLQALNDEFELMNSKKNMLEENIEICSQK 2916

  Fly  3417 IDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPA 3481
            :..|.:||.||..||.||.|:.::|......|.||:|:.|..::|:|.||..||.:.|.: |:.:
  Rat  2917 LIRAEKLISGLGGEKDRWTEAARLLGIRYDNLTGDVLLSSGTVAYLGAFTVDYRAQCQTE-WLIS 2980

  Fly  3482 FKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIK 3546
            .|:.  .||.:........:.|..:|..|...|||.|..|.:|..|:..|.|:|||||||.|..|
  Rat  2981 CKDK--VIPGSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANK 3043

  Fly  3547 WVKTKYGTG-LVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--L 3608
            |||....|. |.|::.|..||:..:|.|:..|:.:|:||:||.:|..:.|:|.:...|:..|  :
  Rat  3044 WVKNMEKTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYM 3108

  Fly  3609 KIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAM 3673
            ::|:..|:::..|:..:.|:|.||||.||:..:..|:||.:|..||:||||..|...|:|:||..
  Rat  3109 RLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEK 3173

  Fly  3674 RTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGV 3738
            :.:|..:....|..||.:||.:|..||.:..|:|||.|.:..|..:|..::||..|...|.:|..
  Rat  3174 KNKLILESAENKKQLKEIEDKILEVLSLSEGNILEDETAIKVLSSSKILSEEISEKQEIASVTET 3238

  Fly  3739 QIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLI 3803
            |||..|..|:|.|..::.|:|.::||..|.|:||:||..|..::..::..:..:::|..|:|.:|
  Rat  3239 QIDETRMGYKPVAIHSAAIFFCISDLAHIEPMYQYSLTWFINLYVLSLANSNKSDELDLRIEYII 3303

  Fly  3804 DSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR------FPYMPNQTSNF 3862
            :..|...:....|.|||:|||:|...|.|.:|.....::.....|||.      .|: ||.... 
  Rat  3304 EHFTLSIYNNVCRSLFEKDKLLFSLLLTIGLLKEKKAIDEEVWYFLLTGGVALDNPF-PNPAPE- 3366

  Fly  3863 TWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMR 3927
             ||:...||.|...::....|||..|:..:...||...||..|::|..|..|....|::::.|:|
  Rat  3367 -WLSEKSWGEIVRASSLPKLKGLMDDLSRNLTEWKAIYDSAWPQDESLPSPWVFLQALEKMAILR 3430

  Fly  3928 CIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSL 3992
            |:|||::..|::.||.|.:|..:|:|.:.:...::.:||....:.|:||||.||:..:.|....|
  Rat  3431 CLRPDKIVPAIQDFISETMGKVFIEAPTFDLQGSYNDSSCCAPLIFILSPGADPMAGLLKFADDL 3495

  Fly  3993 GFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSL--SNVH 4055
            |..  .....::||||||..:|...|..|...|.||:|||.||...|:|:|||..|..:  .|.:
  Rat  3496 GMG--GTKTQTISLGQGQGPIAAKMIHKAIHEGTWVVLQNCHLATSWMPALEKICEEVIIPENTN 3558

  Fly  4056 TSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKAL--DNFSDET-LEMCSKET 4117
            ..:||:|::.|     :...|..||::.||:|||||.|:.||:.::.  |..||.. .:.|:|..
  Rat  3559 RDFRLWLTSYP-----SEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCTKPV 3618

  Fly  4118 EFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFG 4182
            .::.:||.||:|||:|.|||.:|..|||..|.||..||.||:..:..:|.....||:|.|.||.|
  Rat  3619 IWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYKEVPFEALTYLTG 3683

  Fly  4183 EIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG------FPAPG----ILKYTGYHNYI 4237
            |..|||.:|||.||||..:.|..|           ||:.      :.|||    |..:..|.:||
  Rat  3684 ECNYGGRVTDDKDRRLLLSLLSTF-----------YCKEIETDHYYIAPGQPYFIPPHGSYQSYI 3737

  Fly  4238 D--DNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIE 4299
            :  ..|| :..|.::|||.||:|......:.:||:.|....||.:|||.    .|.:::::.:.:
  Rat  3738 EYLRTLPITAHPGVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSG----KSPQEVVEELAQ 3798

  Fly  4300 DILDKTPTPFNILELMGR---VEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISS 4361
            |||.|.|..||:.|:|..   |.:.|...::. ||..|.|.|...::|||.:|...:||::.:||
  Rat  3799 DILSKLPKDFNLEEVMKLYPVVYEESMNTVLR-QELIRFNRLTKVVRRSLIDLGRAIKGQVLMSS 3862

  Fly  4362 VMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQ 4426
            .:|::...:.:.:||..|...:|||:..|..:.:||:.||...:.|: :...|...|::||:..|
  Rat  3863 ELEEVFNSMIVGKVPAMWAAKSYPSLKPLGGYVADLLARLAFFQEWI-NKGPPVVFWISGFYFTQ 3926

  Fly  4427 SLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADA 4491
            |.||.:.|..|||...|:|.:....:||.| :..:...|.:||||.|||:||||||..:..|.::
  Rat  3927 SFLTGVSQNYARKYTIPIDHIGFEFEVTSK-ETTMENIPEDGAYIKGLFLEGARWDRTIRQIGES 3990

  Fly  4492 FLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERASK 4547
            ..|.|:..:|::::|.........:::|.|||||...|..|         :|.:..|.:......
  Rat  3991 LPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKH 4055

  Fly  4548 WTLAGVCLLLQ 4558
            |...||..|.|
  Rat  4056 WINRGVASLCQ 4066

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579 115/424 (27%)
P-loop_NTPase 1903..2132 CDD:304359 147/229 (64%)
P-loop_NTPase 2217..2352 CDD:304359 54/142 (38%)
P-loop_NTPase 2510..2783 CDD:304359 85/281 (30%)
P-loop_NTPase 2860..3127 CDD:304359 103/277 (37%)
MT 3140..3480 CDD:289543 106/351 (30%)
AAA_9 3509..3722 CDD:289547 83/216 (38%)
Dynein_heavy 3864..4549 CDD:281078 243/715 (34%)
Dnah3XP_008772869.1 DHC_N2 821..1219 CDD:285579 114/408 (28%)
P-loop_NTPase 1344..1574 CDD:304359 147/230 (64%)
P-loop_NTPase 1660..1801 CDD:304359 55/141 (39%)
P-loop_NTPase 2000..2259 CDD:304359 84/267 (31%)
P-loop_NTPase 2347..2618 CDD:304359 104/279 (37%)
MT 2635..2978 CDD:289543 105/346 (30%)
AAA_9 3007..3222 CDD:289547 83/215 (39%)
Dynein_heavy 3362..4057 CDD:281078 244/722 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.