DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and NLRP3

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001073289.1 Gene:NLRP3 HGNCID:16400 Length:1036 Species:Homo sapiens

Alignment Length:1225 Identity:220/1226 (18%)
Similarity:388/1226 (32%) Gaps:501/1226 (41%)


  Fly  2026 FLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISE--IMLVAEGFQEAR 2088
            |.||..|....|.:|..:|     |.:|.|..|   |.......|.|.:|.  ::...:..:|..
Human    61 FNGEEKAWAMAVWIFAAIN-----RRDLYEKAK---RDEPKWGSDNARVSNPTVICQEDSIEEEW 117

  Fly  2089 LLARKFITLYTLCK----------------------------ELLSKQDHYDWGLRAIKSVLVVA 2125
            :...::::..::||                            |.:|....|. .||.||.     
Human   118 MGLLEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYT-RLRLIKE----- 176

  Fly  2126 GALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSA 2190
               .|..::| |.::|.       |.|..|.:.||                       :.||   
Human   177 ---HRSQQER-EQELLA-------IGKTKTCESPV-----------------------SPIK--- 204

  Fly  2191 LDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEV-------WKTLNKTYQNQKRKPHY 2248
            ::|...|:|          |.....|:|...|.||.||:.:       |.: ...||::      
Human   205 MELLFDPDD----------EHSEPVHTVVFQGAAGIGKTILARKMMLDWAS-GTLYQDR------ 252

  Fly  2249 NDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRD-----QANLGGTGPKWIVLDGDIDPMWIES 2308
                                    .|.||.|..|:     |.:||.     :::....||     
Human   253 ------------------------FDYLFYIHCREVSLVTQRSLGD-----LIMSCCPDP----- 283

  Fly  2309 LNTVMDDNKVLTLASNERI--ALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQS 2371
                           |..|  .:.|..|:||.:........|.....|            |....
Human   284 ---------------NPPIHKIVRKPSRILFLMDGFDELQGAFDEHIG------------PLCTD 321

  Fly  2372 WLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDC 2436
            |  .:....::.:.:::..|.:|....:..||     |:: :.:||   :|||.   |::|.   
Human   322 W--QKAERGDILLSSLIRKKLLPEASLLITTR-----PVA-LEKLQ---HLLDH---PRHVE--- 369

  Fly  2437 PKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHE---TK 2498
                         :.||..:..::.       |.|:|.:|.:|      ...||...::|   |.
Human   370 -------------ILGFSEAKRKEY-------FFKYFSDEAQA------RAAFSLIQENEVLFTM 408

  Fly  2499 KFFP---W---TNLVPQFELDMDLPLQSNLVNTAETTR--LRFFMDTLIE-----ADHPL----- 2545
            .|.|   |   |.|..|.|..      .:|..|::||.  ..||:.:|::     .:|.|     
Human   409 CFIPLVCWIVCTGLKQQMESG------KSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHGLCAHLW 467

  Fly  2546 --------------MLIGPSGSGKTILMNAKLSA----------LPSDK-YSVTNVPFNFYTTSE 2585
                          :|...|......|..|.:||          :..:| ||..::.|..:..: 
Human   468 GLCSLAADGIWNQKILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAA- 531

  Fly  2586 MLQRILEKPLEKKAGR--------------------NYGPIGNKRMIY-------FVDDMNMPEV 2623
             :..:||   |:|.||                    |||......:|:       .|:......:
Human   532 -MYYLLE---EEKEGRTNVPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYL 592

  Fly  2624 DKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDP-RLQRHFCSFAVN 2687
            :|..:.:....||  ::...|.:                 :...|....|.| :|:..:|.:.:.
Human   593 EKKLSCKISQQIR--LELLKWIE-----------------VKAKAKKLQIQPSQLELFYCLYEMQ 638

  Fly  2688 PPS--QDAL--FHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITL----------------H 2732
            ...  |.|:  |..:...||..||:.:..|   .|:.|..:.:.::..                |
Human   639 EEDFVQRAMDYFPKIEINLSTRMDHMVSSF---CIENCHRVESLSLGFLHNMPKEEEEEEKEGRH 700

  Fly  2733 LKVVSSFLPTA---------IKFHYN-------FNLRDIANIFTGV-LYSNS----------ETC 2770
            |.:|...||::         :..|..       |::...:...|.: |..||          ||.
Human   701 LDMVQCVLPSSSHAACSHGLVNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETL 765

  Fly  2771 --PNSNQMIRLWI------HECYRVYGDKLVDYTDINSFKKIVS-DIVRKGIEGVNDDVV--YAQ 2824
              |..| :.|||:      |||  .:...||    ::|.:|:|. |:        :|:.:  :..
Human   766 QHPGCN-IRRLWLGRCGLSHEC--CFDISLV----LSSNQKLVELDL--------SDNALGDFGI 815

  Fly  2825 PLIYCHFAKGLTDIKYMPISGW-----------DRLKSLLDEAQDRYNDYIGAMNL------VLF 2872
            .|:.......|.::|.:    |           ..|.|:|..:......|:|...|      :|.
Human   816 RLLCVGLKHLLCNLKKL----WLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILC 876

  Fly  2873 DDAMSHVCRISRILESSRGYALLIGVGGSGKQSL--TRLASFISSLDVFQIQLTKDYSVSDLKAN 2935
            :.|.:..|.:.:           :|:..||..|:  :.|:|.:|:                 ..|
Human   877 EKAKNPQCNLQK-----------LGLVNSGLTSVCCSALSSVLST-----------------NQN 913

  Fly  2936 IATLYMKA------GVK-----------------------TSACCF----LMTDSEVAREQFLVL 2967
            :..||::.      |:|                       ||.||:    |:|.|:..|:  |.|
Human   914 LTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRK--LSL 976

  Fly  2968 VND-------------------LLASGDIHELFPDDEVENIVNAVRNEVKQLGIV 3003
            .|:                   ||.:..:.|::.:.|.::.:..::.|..:|.:|
Human   977 GNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVV 1031

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579
P-loop_NTPase 1903..2132 CDD:304359 26/136 (19%)
P-loop_NTPase 2217..2352 CDD:304359 26/149 (17%)
P-loop_NTPase 2510..2783 CDD:304359 69/393 (18%)
P-loop_NTPase 2860..3127 CDD:304359 36/205 (18%)
MT 3140..3480 CDD:289543
AAA_9 3509..3722 CDD:289547
Dynein_heavy 3864..4549 CDD:281078
NLRP3NP_001073289.1 Pyrin_NALPs 10..93 CDD:260032 12/40 (30%)
FISNA 144..209 CDD:291170 19/108 (18%)
NACHT 220..389 CDD:283404 47/274 (17%)
LRR_RI 575..951 CDD:238064 73/445 (16%)
LRR 1 742..762 4/20 (20%)
leucine-rich repeat 743..771 CDD:275380 7/28 (25%)
LRR 2 771..792 7/24 (29%)
LRR 3 799..819 5/28 (18%)
leucine-rich repeat 800..828 CDD:275380 5/36 (14%)
LRR 4 828..849 3/25 (12%)
leucine-rich repeat 829..856 CDD:275380 5/31 (16%)
LRR 5 856..876 4/20 (20%)
leucine-rich repeat 857..881 CDD:275380 5/24 (21%)
LRR_RI 885..>1031 CDD:238064 29/176 (16%)
LRR 6 885..906 5/32 (16%)
leucine-rich repeat 886..913 CDD:275380 7/55 (13%)
LRR 7 913..933 5/20 (25%)
leucine-rich repeat 914..942 CDD:275380 4/28 (14%)
LRR 8 942..963 4/21 (19%)
leucine-rich repeat 943..970 CDD:275380 7/27 (26%)
LRR 9 970..991 4/23 (17%)
leucine-rich repeat 971..990 CDD:275380 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.