DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and LOC110439139

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_021329571.1 Gene:LOC110439139 ID: Length:1639 Species:Danio rerio

Alignment Length:1670 Identity:541/1671 (32%)
Similarity:888/1671 (53%) Gaps:116/1671 (7%)


  Fly  2971 LLASGDIHELFPDDEVENIVNAVRNEVKQLGIVD-NRENCWKYFIEKVRSLLKVVLCFSPVGATL 3034
            :|.||::..||..||::.::.|:..:.|:.||.: ||:..:::||.:||..|.:|||.||||.:.
Zfish     1 MLNSGEVPNLFEKDELKQVLAAISPKAKEAGISEGNRDEVYQFFITRVREKLHIVLCMSPVGDSF 65

  Fly  3035 RVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISK 3099
            |.|.|.||:||||.|||||.:||::||.|||..|...:....:|:....|.....:|.:|.|:::
Zfish    66 RSRCRMFPSLVNCCTIDWFVQWPREALLSVSQTFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAE 130

  Fly  3100 LYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKV 3164
            .:.:..:|:.||||.|:||||.||..:|.||.:.....|.|::|||.||....:.||.::..|..
Zfish   131 RFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSA 195

  Fly  3165 QEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPAL 3229
            .|..|..|:.:...|:..:..:.|...:.|....::|...:...|:..|.|...:.|..:|.|||
Zfish   196 LEPVLAQKSIDVSALMEKLAVDQENADQVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPAL 260

  Fly  3230 IAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFL 3294
            .:|.:|||.|:|.:::|::.|..|||.|::|..||.:|.|:|      ..|.:.:..:|: ..||
Zfish   261 DSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNK------TDWASAKQLLGD-GNFL 318

  Fly  3295 DNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKER 3359
            ..|::|||.:|.|.:::.|..||.:.:|.|||:...|.|...:|.||..::.:..|...|.||..
Zfish   319 KKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKRE 383

  Fly  3360 ALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLI 3424
            .|..::.|:......|.....:|.|:|.|:..||.:::.::|:|:......:.|...:..:.:|.
Zfish   384 KLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQDQFESSMAEKETLAKTMALTEARLGRSGKLT 448

  Fly  3425 GGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPI 3489
            ..|..|::||.||:.:....|..:.|::.|.:..::|.|.||..|||.|.:. |:...::.  .|
Zfish   449 SALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDH-WITRCQSL--GI 510

  Fly  3490 PSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTK-YG 3553
            |.:|......::.|..:|.:||.:|||.|.:|.||..::::..|:|||||||.|..:|:::| ..
Zfish   511 PISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETK 575

  Fly  3554 TGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREID 3616
            .||.|::|:...:|..:|.|:..|..:|:|.:.|.:||.|.|:|.:|....|  |::::||.:||
Zfish   576 NGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDID 640

  Fly  3617 FNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQ 3681
            ::..||..:.||:|||||.||:..:.|:||||||:.|||||:|::||::||||||..|::|..:.
Zfish   641 YDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRI 705

  Fly  3682 NHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREA 3746
            |..:..||.:||.:|..|.::..|:|::..||..|:::|.|:..|:.::.||:.|...|:.|||.
Zfish   706 NADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREK 770

  Fly  3747 YRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKD---RVENLIDSITF 3808
            |||.|.|.||:||::..|.:|:|:||||||.|..:|||.:   .:|||.||   |::.|:|....
Zfish   771 YRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTI---ESAEKHKDLSLRLQILLDQTLL 832

  Fly  3809 CSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR--------FPYMPNQTSNFTWL 3865
            .::...|||||||.|.|:...||::|::..||:...|..:.||        .|..|    ...||
Zfish   833 SAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGEISQQEWLYFLRGAGGIRKELPEKP----EVPWL 893

  Fly  3866 THVGWGGIRALNNQ-AVFKGLEKDIEG--------------SHKRWKKFVDSESPENEKFP---- 3911
            :...|.....|.:: ..|.|::|:|..              |.:.|..:|....|.:|:.|    
Zfish   894 SDFAWETCCNLEDRLPCFNGIKKEIISTPISVKLGQLEVTVSPEHWDGYVTDLPPFSEEIPSEKQ 958

  Fly  3912 ----GEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHI 3971
                |.|..: .|.|:|.:::....:::..|:..|:...||.::::...::.:..:.:.||...:
Zfish   959 PQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPPVDLTTLYADMSPSIPL 1023

  Fly  3972 FFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLV 4036
            .|:||.|.||:...::.....|:   .:...|:||||||..:||..|:.|.:.|.|:.|||.||.
Zfish  1024 VFILSTGSDPMGAFQRFANEKGY---QDRVKSISLGQGQGPIAERMIKEALKNGIWIFLQNCHLA 1085

  Fly  4037 ARWLPSLE---KKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANI 4098
            ..|:.::|   |......:.:|..:|||||:.|     .::.|..:|::::|:|||||.|:.||:
Zfish  1086 VSWMLAMEELIKSFNEPDTVIHEDFRLFLSSMP-----TNVFPVTVLQNSVKVTNEPPKGLRANV 1145

  Fly  4099 HKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLY 4163
            .:|....|....|......:::.|:|.:|:|||::.||:||||.|||..|.||..|...::..|.
Zfish  1146 RRAFTEISSTFFEEHILGRKWRKIIFGVCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLN 1210

  Fly  4164 NYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQG--FPAPG 4226
            .|.:.. .:||:.|.|:.|||.|||.:||.||:|..||.|:.|.....::....|.:.  :.||.
Zfish  1211 LYCQTG-HIPWDALTYITGEITYGGRVTDAWDQRCLRTILKSFFSLATLEEGYTYSKSGIYFAPD 1274

  Fly  4227 ILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQE 4291
            ....|.|..||:|....:.|.::|:|.||.:.|....:..:...:.|:||| :..:.||:  |.:
Zfish  1275 SDSLTEYKQYIEDLPLIDDPEVFGMHENANLAFQRQETMTVINTILEVQPR-SSAAGGGK--SND 1336

  Fly  4292 DIIKNIIEDILDKTPTPFN---------ILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLN 4347
            :::..:::.||.|.|...:         :.:..|||...:   .|..||.:|.|.|:..||.||.
Zfish  1337 EVVHELVDSILAKIPDKLDMDAAVESLFLQDPKGRVNSLT---TVLGQEVDRFNFLLRVLKTSLC 1398

  Fly  4348 ELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFR 4412
            .|...:.|.:.:|..||.:......:|||:.|:..||||:..|.||..||.||...:|.|:.. .
Zfish  1399 TLQKAIAGLVVMSEEMEKIYNSFLNNQVPDHWSNAAYPSLKPLGSWVRDLNLRTAFIENWITR-G 1462

  Fly  4413 MPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEEL-------TTAP----- 4465
            .|.|.|::|||.||..||..:|..|||...|:|.:....::...::::.       |.||     
Zfish  1463 QPKSFWISGFFFPQGFLTGSLQNHARKYNLPIDELNFRFNMVPVYRDQTLVTEAQKTLAPGKELD 1527

  Fly  4466 --------REGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECP 4522
                    .:|..::|:||:..|||.....:.||..:.:.|.:||::.:. .|:.....::|..|
Zfish  1528 MDQELPNIEDGVLVHGMFMDACRWDDTSMVVEDALSRVMNPMLPVVHFEP-QQNYVPEPSLYHAP 1591

  Fly  4523 VYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
            :||...|..|         ||.|..|.|.:.:..|......||.|
Zfish  1592 LYKTSARAGTLSTTGHSTNFVVTVMLPSNQPSDYWISKASALLCQ 1636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579
P-loop_NTPase 1903..2132 CDD:304359
P-loop_NTPase 2217..2352 CDD:304359
P-loop_NTPase 2510..2783 CDD:304359
P-loop_NTPase 2860..3127 CDD:304359 64/157 (41%)
MT 3140..3480 CDD:289543 99/340 (29%)
AAA_9 3509..3722 CDD:289547 90/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 218/752 (29%)
LOC110439139XP_021329571.1 MT <1..1254 CDD:330758 434/1279 (34%)
AAA_9 530..747 CDD:315453 91/217 (42%)
Dynein_heavy 892..1634 CDD:308587 219/759 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.