DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001028840.1 Gene:Dnah1 MGIID:107721 Length:4250 Species:Mus musculus

Alignment Length:4471 Identity:1369/4472 (31%)
Similarity:2195/4472 (49%) Gaps:633/4472 (14%)


  Fly   465 LEKILEEYNSIYREWTNIQYNPIDPDAEN-----SLFQRDRLSFKAKTDVMERMVSFQFEKGLED 524
            |||||:|.|  |..    :.||::||.:.     :..::.|.|....||   :......::|...
Mouse    29 LEKILQESN--YHP----ERNPLNPDPKTPPLPLTDLRQPRKSPLTGTD---KKYPLMKQRGFYS 84

  Fly   525 THDLLLAGSL---------------LLRPIIKKHVEPLM--HVIVDDFEEEIMCVKKEFINFKNV 572
              |:|..|:|               |:|........|.:  .||.:||:|.   |:::.|.... 
Mouse    85 --DILSPGTLDKLGNVCCGPYMSQNLIRQADLDKFTPKVDSFVIPEDFQER---VEQQIIGATT- 143

  Fly   573 FTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQE 637
             ..|...:.|.....|||......|.....|.|.:.:..:.|           ...||..::..|
Mouse   144 -RLLTQTDFPLQSYEPKVQVPFQVLPGQCPRKIEIERRKQQY-----------LRLDIEQLLTSE 196

  Fly   638 IDDFTKMLLDKWTVECWQGIQQD--------ITLTLIEKDEANELRVNFTERLIFALKDIKVVRL 694
            ..|..|::.....::..|.|:|.        :.|.:.:.:|                        
Mouse   197 GIDSNKLMPRHPDLQHPQTIEQGRDPLFPIYLPLKVFDNEE------------------------ 237

  Fly   695 LGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQM------ 753
                       |.||..            .||.|...|......|.:....::..::.:      
Mouse   238 -----------FDCRTP------------TEWLNMGLEPGSQNRKPVPGKALLPTDDDLGHEDPK 279

  Fly   754 KPLLDFIKWNAFSQRFIVMIFKMVKYLH-----DR--LVAAQENLEAIKESIRSWGKVPLFQRKD 811
            ...||: :|....    |:.:...|.|:     |:  ||..:..:..:...|...|:.||...:.
Mouse   280 NQELDY-RWCEVG----VLDYDEEKKLYLVQKTDKRGLVRDEMGMPILNGGITPAGRPPLLATQY 339

  Fly   812 LNPALLL---HTDPREPILSIRAANAADTQRLID-LLMYVNLKLFFDIPRRYSLPPGEHGEEDEE 872
            ..|.:.|   ..|||  :.:.|...|...::..: ||||   .|:.|     .:|          
Mouse   340 WVPRIQLLFCAEDPR--VFTQRVVQANALRKYTEALLMY---NLYVD-----CMP---------- 384

  Fly   873 SDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHR--YELLKGLSQEE 935
            ::|                   |.||:|: .|.:.:      :..:.||..|  ..:|:.||...
Mouse   385 TEG-------------------RRVINEQ-SLSKIK------QWALSTPRMRKGQSVLEHLSCLA 423

  Fly   936 RALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTS 1000
            |.:..:||..:::|..:.:|.|  ...|:..:.:..:.|...|...:....:.|    ||    .
Mouse   424 REVNLDYERSMNKINFDQIVSS--NPETFSYVTLPEKEEEKVPNQGLVSVPEYP----FR----E 478

  Fly  1001 SKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPY----SFYDELQDKSELDKQ---RVEI 1058
            .|..|.|   ..|.....:::.|.:|..:..:||:|:.:    |.|..|::..::..|   :|::
Mouse   479 QKEDFTF---VSLLTRPEVITALSKVRAECNKVTSMSLFHSSLSKYSRLEEFEQIQSQTFSQVQM 540

  Fly  1059 MNK------IKLALQ-AVRVHGKGFME-FSSLW---IWDKSTYLSEVKKFGRNLTL--------- 1103
            ..|      :|:|:: ::|...||:.. :.:.|   :..|...|.|:.|:....||         
Mouse   541 FLKDSWISTLKVAMRGSLRDMSKGWYNLYETNWEVYLMSKLRKLMELIKYMLQDTLRFLVQDSLG 605

  Fly  1104 -----------------DERDAEADLEGS------------------SGV----KLLGLEYPPLS 1129
                             |:.|...||..|                  |||    .|...|...|:
Mouse   606 SFTQFIGDACCSVLECVDDMDWGEDLVNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMILLN 670

  Fly  1130 VYKE---------QLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVG---QWISLFKL 1182
            ::.:         ||:|.:           .||.|:      :|  ..:|..||   ..:...:.
Mouse   671 LFDKGILATHAVPQLEKLV-----------MEDIFI------SG--DPLLESVGLHEPLVEELRA 716

  Fly  1183 DLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILS------------VLNQINEKQ--- 1232
            ::.|.:..::..||.:..|....|  ||..:|....:|...            |:..:.||:   
Mouse   717 NITNAMHKAMMPLQAYAKEYRKYL--ELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILD 779

  Fly  1233 ----------------------------CIYDSMFDPL-----KEIIDLLRQYN------YEFKD 1258
                                        .:..||.|.|     ||:..:..::.      || |.
Mouse   780 NSLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYE-KP 843

  Fly  1259 TELAQINELPDAWMK--VKRLAATTKQLIAPIQSYQV-----------DLIEKRILLCDNMANTY 1310
            ..:.::.||.| |||  .::|....::::..:..|:|           |..:|.      .||.:
Mouse   844 NSIEELAELRD-WMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKW------AANNW 901

  Fly  1311 RKKFL-------------SKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDP 1362
            ..|.|             .:||..:      :|:|:::.: ..||..|..:|..::..|:.....
Mouse   902 PSKILGQIDMVRQQHVEDEEKFRKI------QLMDQNNFQ-EKLEGLQLVVAGFSIHVEIARAHE 959

  Fly  1363 VKIELCR---------------------FDL------KLVKIMWDFA--ITIQSTINDWKK---- 1394
            :..|:.|                     |.|      ||.:::.:|.  :.:.:|.:||.:    
Mouse   960 IANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSES 1024

  Fly  1395 ---TPWKKIDIENMDQ----------ECKKFGRELRGLDKA---MRT----WEPFIFMEASLKNL 1439
               .|...||.|.:::          :|.|..:::....:.   :||    ::|:|.:       
Mouse  1025 WMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPL------- 1082

  Fly  1440 MTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEM 1504
                  :..|:||.:|:|||..|.....:......:.|....:::||.::.|.:..:.:.:.||.
Mouse  1083 ------IQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEY 1141

  Fly  1505 AMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVR 1569
            |:|:.|..:...|.::.|....:..|...:||:.:|..:.|:||....|:|:.|.|...||..:.
Mouse  1142 AIEQALDKMEKEWSSILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRIN 1206

  Fly  1570 LWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADR 1634
            .|:.:|....:::..|...||.|.|||.|| .||||..|||.:|:|:..:::.::.::.....:|
Mouse  1207 SWETKLKLTQEVLEEWLNCQRAWLYLEPIF-SSEDITRQLPVESKRYQTMERIWRKIMKNAYENR 1270

  Fly  1635 NVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPAL 1699
            .|:...  |..:|.:.|....|:|.|.:|.|::||||||.::|||||:|..:||:|||...:|..
Mouse  1271 EVINVC--SDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTA 1333

  Fly  1700 VARHLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRD 1764
            |..||.|.::::.:| |.........|.:.|.|| |....:...|..||.||..:...|:.::.|
Mouse  1334 VQPHLRKCFENIARL-LFQEDLEITHMYSAEGEE-VKLSFSIYPSSNVEDWLLEVERSMKASVHD 1396

  Fly  1765 QLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAF--AKVQQRYENALKDYNKKQITQ 1827
            .::.::..|....|..|:..||.|..:.|.|..||.|..:|.  ..:..:....|.       .|
Mouse  1397 IIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLS-------KQ 1454

  Fly  1828 LNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDC 1892
            |::|:.|:.|.|:..:|..:..:..|:||::|||..:|.:.|.....|:|.||||:.|..  ||.
Mouse  1455 LSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTK--DDL 1517

  Fly  1893 FANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRA 1957
            :....:|:|.|.||||||:.||||||||||||:|||.:|||..||||||||||||||||||||:|
Mouse  1518 YIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKA 1582

  Fly  1958 LGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQ 2022
            |.:...|||||:|:|:.::|...||||..|||.||||||||.:|||||||.|:..||.|.:.:.:
Mouse  1583 LAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVE 1647

  Fly  2023 TFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEA 2087
            .|.|.|..|.|..:..||||||||||||.|||:|||||:||.||:|||:|:|:||.|.:.||.||
Mouse  1648 RFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEA 1712

  Fly  2088 RLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPK 2152
            .:||:|..|.:.|..|.||.|||||:|:||:|:|:..||.|:|::....|:.:.:||:||.|:||
Mouse  1713 NVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPK 1777

  Fly  2153 IVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHS 2217
            .:.:|:.:|.|::.||||.:..........:..|:||.....|:..:||::|.:||.|...|||.
Mouse  1778 FLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHG 1842

  Fly  2218 VFIIGFAGTGKSEVWKTLNKTYQNQKRKP----------HYNDLNPKAVTNDELFGIVNPSTREW 2272
            :.::|..|:|||..::.|.......|.||          :|..||||::|..:|:|..:..|.||
Mouse  1843 LMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEW 1907

  Fly  2273 KDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLF 2337
            .||:||.|:|..|....|..||.:.||.:|.:|||::|||:||||.|.|:|.|.|.||:.|.::|
Mouse  1908 TDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMF 1972

  Fly  2338 EIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLG--TRTNSSEVSMLNVLFDKYVPPLLDIF 2400
            |:..|..|:||||||.|::|:.|..||..||::.||.  .............||.||:...::..
Mouse  1973 EVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRLPAIIKPYEEQFKSLFTKYLENSINFV 2037

  Fly  2401 RTRLRSITPISDIARLQMTCYLLDSMLTP-------QNVPND----CPKDWYEIYFVFCIVWGFG 2454
            |..::.:...::.........|||....|       :.:|::    .| :..|.:|:|.:||..|
Mouse  2038 RNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKKIPSEKLSHIP-ELIEPWFIFSLVWSVG 2101

  Fly  2455 SSLFQDQIIDWSNEFSKWF-----LNEYKAVKFPLSGTIFSFYID--------------HETKK- 2499
            ::......|    .||:|.     |.:.| :.||..|.::.:.:|              .|.|: 
Mouse  2102 ATGDHTSRI----SFSQWLRLKMRLEQVK-LGFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQV 2161

  Fly  2500 -FFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKL 2563
             :..|.:....|.:..|....:.:|.|.:|.::.:.:..|:....|::.|||:|:|||:.::.||
Mouse  2162 SWVKWMDYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKL 2226

  Fly  2564 SALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFT 2628
            ......:|....:.|:..|::...|.:::..|:|:....:||...:..|:|:||:|||.::.|..
Mouse  2227 LKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGA 2291

  Fly  2629 VQPHTLIRQFMDYHHWYDRQKM-TLRDIHKCNIVACMN-PSAGSFTIDPRLQRHF--CSF-AVNP 2688
            ..|..|:||:||:..||||:.: ..:::...|.|..|. |..|...|.|||.|||  .|| .::.
Mouse  2292 QPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDE 2356

  Fly  2689 PSQDALFHILNSILSQHMD---------NPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAI 2744
            .|:..:|.|   ||...||         .|:..... :..|.|.:|...|.::..:.|..|||..
Mouse  2357 VSKKRIFSI---ILECWMDGLLGEKSYREPVPGAPN-IDDLTEPLVDATINVYGIITSQLLPTPA 2417

  Fly  2745 KFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIV-SDI 2808
            |.||.|||||::.:|.|:|.:......:..|::|||.||..||:.|:||:..|.:.|.::: :.:
Mouse  2418 KSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQM 2482

  Fly  2809 VRKGIEGVNDDVVYAQPLIYCHFAKGLTDIK-YMPISGWDRLKSLLDEAQDRYNDYIGA-MNLVL 2871
            ...|:  ..:.|...||::|..|....:|:| |..|:...::..:::|..:.||....| :.|||
Mouse  2483 EEFGV--AFNKVCPFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQINTAKLRLVL 2545

  Fly  2872 FDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANI 2936
            |.|||||:|||||.|..:.|.|||:||||||:.|||||||.::..:.|||:|:|:|.:|:.:.::
Mouse  2546 FVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDV 2610

  Fly  2937 ATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLG 3001
            ..:.:|||::.....||.:|:::..|.||..:|::|.||||..::..||.:.|:|.:|..:::.|
Mouse  2611 KKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMRPYIQEQG 2675

  Fly  3002 IVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSL 3066
            :...:.|....:..:|||.:.:|||.||:|...|.|.|:||:||||.|||||:|||.:||:||:.
Mouse  2676 LQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVAT 2740

  Fly  3067 RFLSEITVL--PKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHE 3129
            .|||||..|  .:|:...:.....|:|::|......|||...|:||.||||:|||:.::|.|:.:
Mouse  2741 TFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQ 2805

  Fly  3130 KVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEA--DNLIIVVGTENEKVSK 3192
            |.......:.|:::||.||...:::|..:|:.|::....|    :||  |.::.:     |::..
Mouse  2806 KKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLL----EEAAKDTMLTM-----EQIKV 2861

  Fly  3193 ERAFASKEEKNVRQIEEDVTAKAKL---------CEEDFLKAQPALIAAQEALNTLNKNNLTELK 3248
            :.|.|.:..|:|:  .|::.|..|.         .::|..:|.|||.||..:|..||||::||::
Mouse  2862 DTAIAEETRKSVQ--AEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVR 2924

  Fly  3249 SFGSPPDAVVSVCGAVLVLFSSKGKIPK-----------DRSWKACRAFMGNVDKFLDNLINYDK 3302
            :...||..|..|..||.::   ||..||           |..|:..:..:.:..:||::|..:||
Mouse  2925 AMQRPPPGVKLVIEAVCIM---KGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDK 2986

  Fly  3303 KHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKE 3367
            .:|...||||:||||.:.||.|..|...|.|...:|.||..:::::.|...||||.:||.|::.:
Mouse  2987 DNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDD 3051

  Fly  3368 VKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKI 3432
            ::..:..|......|.|:|:.:..:|.:|.|.:|||::.:.:..:....:..|::||.|||.||:
Mouse  3052 LEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKV 3116

  Fly  3433 RWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAF------KNSQPPIPS 3491
            ||.|:|:.|...:..:.||:|:.:.|::|:|.||..||..|.| .|:...      ..|:|.:.:
Mouse  3117 RWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYE-YWVNQLTVHHVPHTSKPTLIT 3180

  Fly  3492 TDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTG 3555
            |.|        :..:|..|...|||:|.:|.||..|...|:|:...||||.|..||:|. :..:|
Mouse  3181 TLG--------NPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESG 3237

  Fly  3556 LVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKK--GTVLKIGDREIDFN 3618
            |.|.:||.|::|..:|.|:..|...|:||:||.:||.|.|:|.:|..|:  ..|||:||..|.::
Mouse  3238 LDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYH 3302

  Fly  3619 SRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNH 3683
            ..||:.:.|||.||||.||:..:.||||||::..|||||||.:||..||||||..:.:|......
Mouse  3303 EDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAK 3367

  Fly  3684 FKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYR 3748
            .:..||.:||.:|.||||:..|.::|:.|:..||.:|..|.||:.||..|:.|...||..|..|.
Mouse  3368 MRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYI 3432

  Fly  3749 PAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVY 3813
            |.|.|..|::|.::||..::|:||:||:.|..:|.:.:..:..|:.||.|:.|:...:||..:..
Mouse  3433 PVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSN 3497

  Fly  3814 TSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFT--WLTHVGWGGIRAL 3876
            ..|.|||:.||:|...||::|::|.|::...|..:||....:.....|..  ||:...|..|.||
Mouse  3498 VCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGGSIQTMFENPAPQWLSDRAWRDILAL 3562

  Fly  3877 NNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKG-KSAIQRLCIMRCIRPDRMSYAMRS 3940
            :|...|.....|.......::...||..|..|..||.|.. ....|:|.|:||:|.|:::.||:.
Mouse  3563 SNLPTFATFSNDFVMYLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQD 3627

  Fly  3941 FIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVS 4005
            |:...|..::|:.::...|..|:||:..|.:.||||||.||..|:.|..:.:.||   :.|.::|
Mouse  3628 FVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFS---KKFSAIS 3689

  Fly  4006 LGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGD 4069
            |||||...||..:..:.:.|.||..||.||...|:|:||:.:|. :...||..:||:|::.|:..
Mouse  3690 LGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNK 3754

  Fly  4070 PAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVA 4134
                 .|..||::..|:|.|||.|:.||:.|:.::.||:.|..|.|..|||::|.|||.||....
Mouse  3755 -----FPVSILQNGSKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNAL 3814

  Fly  4135 ERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLC 4199
            |||||||.|:|..|.|..|||.|.:..|..:|:....:|::.|:|..|||.|||.:|||||||..
Mouse  3815 ERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCV 3879

  Fly  4200 RTYLEEFMQPELIDGELEYCQG---FPAPGILKYTGYHNYIDDNLP-SESPSLYGLHSNAEIGFL 4260
            ...||:|..|.::..|..|...   ...|......||.:|| .:|| ::.|.::|||.||.|.|.
Mouse  3880 MNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYDLNGYLSYI-KSLPLNDMPEIFGLHDNANITFA 3943

  Fly  4261 TTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYI 4325
            ...:..||..:.:|||:  ..|.||:  |:|::::::.|:||.:.|.|..:.|    |..:.|.:
Mouse  3944 QNETFALFNAILQLQPK--SSSMGGQ--SREELVEDVAENILLQVPGPIELQE----VTKKFPVL 4000

  Fly  4326 ------IVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAY 4384
                  .|..||..|.|.|:..:.::|:::...:||.:.:|..:|.:.:.||.:.|||.|...||
Mouse  4001 YEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAY 4065

  Fly  4385 PSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCL 4449
            ||:..|.||..||:|||..:..|:.| .:|...|::|||.||:.||..:|..|||....:|.:..
Mouse  4066 PSLKPLASWIMDLLLRLDFMHSWIND-GIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITF 4129

  Fly  4450 NCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQD 4514
            :..|..:...|:...|:.|.||:|||:||||||.....:|::..|||:..|.|:::......|..
Mouse  4130 DFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQ 4194

  Fly  4515 IKNVYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLL 4556
            .::.|.||:||...|..|         :|....:.|.:....|...||.|:
Mouse  4195 NQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALI 4245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 61/334 (18%)
DHC_N2 1368..1770 CDD:285579 117/455 (26%)
P-loop_NTPase 1903..2132 CDD:304359 144/229 (63%)
P-loop_NTPase 2217..2352 CDD:304359 60/145 (41%)
P-loop_NTPase 2510..2783 CDD:304359 88/287 (31%)
P-loop_NTPase 2860..3127 CDD:304359 119/270 (44%)
MT 3140..3480 CDD:289543 113/362 (31%)
AAA_9 3509..3722 CDD:289547 95/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 247/706 (35%)
Dnah1NP_001028840.1 Stem. {ECO:0000250} 1..1527 359/1699 (21%)
DHC_N2 1005..1401 CDD:312039 112/414 (27%)
MT <1237..3883 CDD:330758 985/2702 (36%)
AAA 1. {ECO:0000250} 1528..1749 140/221 (63%)
GPAGTGKT motif 1566..1573 7/7 (100%)
CFDEFNR motif 1616..1622 6/6 (100%)
AAA 2. {ECO:0000250} 1809..2042 88/233 (38%)
AAA 3. {ECO:0000250} 2174..2434 80/264 (30%)
AAA 4. {ECO:0000250} 2532..2784 108/252 (43%)
Stalk. {ECO:0000250} 2799..3097 90/312 (29%)
AAA 5. {ECO:0000250} 3182..3412 100/238 (42%)
Dynein_heavy 3550..4245 CDD:308587 250/713 (35%)
AAA 6. {ECO:0000250} 3625..3844 90/227 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.