DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah12

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_001357813.1 Gene:Dnah12 MGIID:107720 Length:3960 Species:Mus musculus

Alignment Length:4040 Identity:1284/4041 (32%)
Similarity:2057/4041 (51%) Gaps:409/4041 (10%)


  Fly   736 PTEKRLIAAEMILIEEQMK----------PLLDFIK--WNAFSQRFI---VMIFKMVKYLHDRLV 785
            |.:.:.:...::|:.|.:|          .|:|.:.  :....:|::   |::...||:|.|...
Mouse   110 PIQSQWLDNMLMLVPEHLKEGEKSEELLGSLIDEVSMDYEKSMKRYLVQSVLVKPPVKWLEDEGG 174

  Fly   786 AAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLK 850
            ...|:.|.:..|               ||........|..||    ||.......:.:|:.:...
Mouse   175 PLPESPEGLDYS---------------NPWHSNFVQARSQIL----ANLHIVHPTMKMLLELGYT 220

  Fly   851 LFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESE 915
            .|..|                             ::..:...:.|..||.|....:...:..:||
Mouse   221 AFAKI-----------------------------ILLDLTGIRARGPIDCEALRNDLSIQARKSE 256

  Fly   916 EEI--------ITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVI--TSSTYLRMEVD 970
            |:|        |..|.:.|.|:|:..|:...|  |...  .|:..|.:..::  |...:::: .|
Mouse   257 EKIMNTWYPKVINLFTKKEALEGIKTEKLDSF--YNCV--SILMSNQLKDLLWRTVEEFIKL-FD 316

  Fly   971 NRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTN 1035
            .||.|..|||::.:...:..:.::.....             |:|:  ::.|::|:::  |..|.
Mouse   317 PRYLNRLPIFKMELTFDDDKMEFYPTFQD-------------LEDV--VLGLIERISE--TLQTV 364

  Fly  1036 MNPYSFYDELQDKSELDKQRVE---------IMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYL 1091
            ....|:.........||.:..|         :...|:..|:..:.|.|.::...: |:.| .|..
Mouse   365 QTVPSWLSGTSSPVNLDTEIPEHVLQWALCTLRTAIQHNLEGAKAHHKTYVTKYN-WLLD-GTAT 427

  Fly  1092 SEVKKF-GRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIR---TWETYE 1152
            ..:::| ..|.|.||                         |.|.::||..|..:|.   .|..|.
Mouse   428 KMIQRFQAENHTFDE-------------------------YTEFIEKFFNLASEIMLLPQWAHYP 467

  Fly  1153 DFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQ-KDDFE 1216
                .:||:....|:.:.::...:.::...|:.::.:   ||.:....|...:....|: .:..|
Mouse   468 ----MVRLDCEDLKIGLTNKARAFANILLNDIASKHR---KENESICSEFEAIRDHALRVPETTE 525

  Fly  1217 GLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAAT- 1280
            .::::::.:.:....     .:.|....|.:..||.:| |.|..|....:|        .|.|| 
Mouse   526 EMMELIAFVERARTV-----GILDLALRIQESKRQMSY-FLDALLMSQEDL--------NLNATV 576

  Fly  1281 ----TKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKF---LSKKFFFVPCLSCYELIDESDLEL 1338
                ||  |.|:.....:|||......:|.....|:|.   :.|:...:...:.:..:|.....:
Mouse   577 LLWPTK--ITPVFDENDELIENAKHAKENELIAKREKLILEIEKESRRMEEFTEFAELDRMHQYV 639

  Fly  1339 VALEERQRSLAES--AVLFELQGPDPVKIELCRF-DLKLVKI-------MWDFAITIQSTINDWK 1393
            ..:.:.|:.:.||  ||.|..:..:..|.||.:: :|:.:|:       .::|.:..|.|...|.
Mouse   640 ADVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELEKLKVTIEPYQKFFNFVLKWQRTEKRWM 704

  Fly  1394 KTPWKKIDIENMDQECKKFGR---------------ELRGLDKAMR-------------TWEPFI 1430
            ...:..::.|:|:.:...|.|               ||:...||.|             ...|.|
Mouse   705 DGGFLDLNGESMEADIDDFSREVFRTLKFFHAKQKKELQERRKAARKRSLMEEKPEEEPKENPTI 769

  Fly  1431 FM----EASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEE 1491
            .|    ...:|:....:..|:.|.||.:|.|||.::.:......:.|..|||:.::.|||..|.|
Mouse   770 TMCTTVMEQIKSFKEYIPTVSILCNPGMRARHWKQMSEIVGYDLTPDSGTTLRKVLKLNLSPYLE 834

  Fly  1492 EVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMA 1556
            ..:.|...:.||.::|:.:..:...|..:.|...::..|.|.:|.:.:|:...|:|...:.|.|.
Mouse   835 SFEVISAGASKEFSLERSMNAMIATWDDISFHISLYRDTGIGILSSVDEIQAILDDQIIKTQTMR 899

  Fly  1557 SSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDK 1621
            .|.:|..||:|::.|::||....:.|..|.:||.:|.|||.||. ||||..|:||:.|:|..:|:
Mouse   900 GSPFIKPFENEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFC-SEDIMQQMPEEGRQFQTVDR 963

  Fly  1622 EFKALLAQMNADRNVVRSTNRSG--SKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSS 1684
            .:|.::.....|..|:.:|:.:|  .||....::|.|::    |.||.|||.|||.:|||:|:|:
Mouse   964 HWKDIMKFCAKDPKVLAATSLTGLLEKLQNCNDLLEKIM----KGLNAYLEKKRLFFPRFFFLSN 1024

  Fly  1685 ADLLDILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELE--EYVPFLENCDCSGKV 1747
            .::|:|||...:|..|..||.|.::.:.||..:: :.:...|.:.|.|  |.:..:......|.|
Mouse  1025 DEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLA-NLDIKAMYSSEGERVELIALISTTAARGAV 1088

  Fly  1748 EVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQR 1812
            |.||.::.|.|..::||.:..|...|....|..|:.|||.|..|..:|:.||:||.:..:...: 
Mouse  1089 EKWLIQVEDLMLRSIRDVIAASRLAYPESARKDWVREWPGQVVLCVSQMFWTSETQEIISGGTE- 1152

  Fly  1813 YENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQW 1877
               .||.|.|:...|||:::.|:.|.|:...|..:..:.|||||:||||..:|...|...|.|||
Mouse  1153 ---GLKKYYKELQYQLNDIVELVRGKLSKQTRITLGALVTIDVHARDVVMDMIEMGVSHDTDFQW 1214

  Fly  1878 QSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGP 1942
            .:|||:.|:  .::....|.:...:|.||||||:|||||||||||||.||..:.:|.:||||.||
Mouse  1215 LAQLRYYWE--YENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGP 1277

  Fly  1943 AGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVA 2007
            ||||||||||||.:||.:...|||||:.:||.::|...||||.:|||.||||||||.:|||||||
Mouse  1278 AGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVA 1342

  Fly  2008 VQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFA 2072
            .|:.|||.||:.|.:.|.|.|..:.|.....|.||||||||||:|||:|||.|:|..||:||::|
Mouse  1343 QQILCIQRAIQQKLEAFVFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYA 1407

  Fly  2073 LISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPE 2137
            ||:||.|.:.||..|:.|:.|.:..|.||.|.||.|.|||:|:||:|:|||.||.|:.......|
Mouse  1408 LIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENE 1472

  Fly  2138 DQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFI 2202
            |.:|:|:::|.|.||.::.|:|:|.|:..||||.:.:|.....||......:.....|||...|:
Mouse  1473 DILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYKEFLECAHETCQTHNLQPVKFFL 1537

  Fly  2203 LKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTL-------NKTYQNQKRKPHYNDLNPKAVTNDE 2260
            .||:|..|:..|||...::|.....|:||...|       |:.....:.|..|..:|||::|..:
Mouse  1538 EKIIQTYEMMIVRHGFMLVGEPFAAKTEVLHVLADTLTLMNERNYGDEEKVMYRTVNPKSITMGQ 1602

  Fly  2261 LFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNE 2325
            |||..:|.:.||.||:.:...|:.|.......||:|.||.||.:||||:|||:||||.|.|.|.|
Mouse  1603 LFGQFDPVSHEWTDGIVANTFREFALAESPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGE 1667

  Fly  2326 RIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGT-RTNSSEV---SMLN 2386
            .|.::.:|.|:||...|..|:||||||.|::|:.|..|||.|.:.|||.: :...||:   ::|.
Mouse  1668 IIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVASWLNSLKEPLSELEHQNLLK 1732

  Fly  2387 VLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSML--TPQNVPNDCP-KDWYEIYFVFC 2448
            .|||..|||.|...|.:.:.:.|.|:|..:.....|::.:|  ..:|.||... :.|....|:|.
Mouse  1733 ELFDWLVPPSLVFRRKKCKELIPTSNINAVVALTRLIEILLCTVVENEPNSKHIRVWTMASFIFS 1797

  Fly  2449 IVWGFGSS----------LFQDQIIDWSNE-------FSKWFLNEYKAVKFPLSGTIFSFYIDHE 2496
            ::|..|:|          .|....:...||       .|||      ...|...|.::.:..:..
Mouse  1798 LIWSIGASCDTDGRLAFDAFLRTAVSGRNEEAPMPVSISKW------ECPFDEKGLVYDYMYELR 1856

  Fly  2497 TK-KFFPWTNLVPQFEL-DMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILM 2559
            .: ::..|..|:...:| |....:|..:|.|.:|.|..|.||..|.:..||:.:||:|:||::.:
Mouse  1857 NRGRWIHWNELIKSSDLEDKRAKIQDIIVPTMDTIRYTFLMDLSITSAKPLLFVGPTGTGKSVYV 1921

  Fly  2560 NAKL-SALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEV 2623
            ..|| :.|..:||....|.|:..|::..:|.|:...|:|:....:||...|:.:.|:||||||.:
Mouse  1922 KDKLMNHLEKEKYFPFYVNFSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCVIFIDDMNMPSL 1986

  Fly  2624 DKYFTVQPHTLIRQFMDYHHWY---DRQKMTLRDIHKCNIVACMN-PSAGSFTIDPRLQRHFCSF 2684
            :||....|..|:|||.|..|||   |..|:||.||   .::|.|. |..|...:.||..|||...
Mouse  1987 EKYGAQPPIELLRQFFDCGHWYDLKDTSKITLIDI---ELIAAMGPPGGGRNAVTPRFIRHFNIC 2048

  Fly  2685 AVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYN 2749
            .:|..|.:.:..|.:||::.::..  ..|......|...:|:..:.::.:.:.:.|||..|.||.
Mouse  2049 TINTFSDETMVRIFSSIMAFYLRT--HAFSPEYFVLGNQIVSGTMEVYKQSMGNLLPTPAKSHYT 2111

  Fly  2750 FNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIE 2814
            |||||.:.:..|.|....:...:.:.||||::||..||:.|:|::..|.|....::.::::...:
Mouse  2112 FNLRDFSRVIRGCLLIEKDAIESKHTMIRLFVHEVLRVFYDRLINDEDRNWLFLLIKNVIKDHFK 2176

  Fly  2815 GVNDDVVYAQPLIYCHFAKGLTDI-----------KYM--PISGWDRL----------KSLLDEA 2856
            ...|.|.:       |...|...:           .||  .:.|.||:          ..::|:.
Mouse  2177 ESFDTVFH-------HLRNGNAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPDIHHFNEVVDQC 2234

  Fly  2857 QDRYND-YIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQ 2920
            .|.||. :...||||:|...:.|:.||.|||:.|.|.|||||:||||:||||:||:.::.:.:||
Mouse  2235 LDEYNQTHKRRMNLVVFRYVLEHLSRICRILKQSGGNALLIGLGGSGRQSLTKLATSMAKMQIFQ 2299

  Fly  2921 IQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDE 2985
            .:::|.|.:::.:.:|.||....|||.....||:||:::..|.||..::::|.:|::..:|..||
Mouse  2300 PEISKSYGMNEWREDIKTLLRNVGVKGQKTVFLITDTQIKEESFLEDIDNVLNTGEVPNIFAADE 2364

  Fly  2986 VENIVNAVRNEVKQLGIVDNREN------CWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPAL 3044
            .:.::..|| .|.|.|   |:..      .:.:|:.:.:..|.:|:.|||:|...|.|.|:||:|
Mouse  2365 KQEVMEGVR-PVAQAG---NKHGELSPLALFAFFVNRCKDNLHIVVAFSPIGDAFRNRLRQFPSL 2425

  Fly  3045 VNCTTIDWFHEWPQQALESVSLRFLS--EITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKR 3107
            :||.|||||..||:.|||.|::.||.  |:|.:.::..:|:....   |.::..:|:.:|....|
Mouse  2426 INCCTIDWFQPWPEDALERVAVNFLETLELTKVERQEIVPICKHF---HTSIMHLSERFLEELGR 2487

  Fly  3108 YNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIK 3172
            :||.|..|:||||..:.:||.:|.:|.::.:.|..|||.:||....:|..::  |::.|::.|::
Mouse  2488 HNYVTATSYLELIGSFRQLLTKKRQAVMEAKQRYVNGLDQLAFAESQVGEMK--LELVELQPKLE 2550

  Fly  3173 NQEADN--LIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEA 3235
            ..:.:|  ::.::..|:.:|..:|.|...:|:......|:..|....||.|..:|.|||.||..|
Mouse  2551 AAKIENARMMQIIEVESAQVEAKRKFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSA 2615

  Fly  3236 LNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRS---------WKACRAFMGNVD 3291
            |:||...::|.:||..:||..|..|..||.|:...|.:...|.|         |...:..:|:::
Mouse  2616 LDTLKPADITIVKSMKNPPAGVKLVMAAVCVMKDIKPEKISDPSGTGGKIFDYWGPSKKLLGDMN 2680

  Fly  3292 KFLDNLINYDKKHIHPDVIKALQ-PYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVE 3355
             ||.:|..|||.:|...|::.:: .|:.:.||.|.|:...||||.|||.|::.:..:..|..||.
Mouse  2681 -FLRDLREYDKDNIPVAVMQKIRSEYLTNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVA 2744

  Fly  3356 PKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIA 3420
            ||:..|.|:::.:.:..:.|......|.::|..|..|:..:.|...:|...:|:....|..::.|
Mouse  2745 PKKARLAEAQRSLAETMELLNQKRAELAQVEHHLENLEKTFQEKTEEKAALEDQVELCAKKLERA 2809

  Fly  3421 NRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNS 3485
            ::|||||..||.||.::...|....:.|.||:|:.:..|:|:|.||..:|||..|. |....|..
Mouse  2810 SKLIGGLGGEKSRWSQAADDLQITYENLTGDVLVAAGVIAYLGAFTSGFRQECTED-WSKLCKKK 2873

  Fly  3486 QPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVK- 3549
            :  .|.::.....:.:.|..:|..||..|||:|..|.:|..|:..|.|:|||||||.|..||:| 
Mouse  2874 K--FPCSEEFSLSKTLGDPVKIRAWNIAGLPTDAFSIDNGVIVNNSRRWPLMIDPQGQANKWIKN 2936

  Fly  3550 TKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGD 3612
            ::....|.|::||..:|:..:|..|..|:.||:||:||::||.|.|||.:|..|:|.:  :::|:
Mouse  2937 SEKDNQLSVIKLSDTDYMRTLENCVQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGIDCIRLGE 3001

  Fly  3613 REIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRL 3677
            ..|:::..|:..:.|||.||||.||:..:.:|:||.:|.:|||||||..||..|||:||..|..|
Mouse  3002 VIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNAL 3066

  Fly  3678 TQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDS 3742
            ..|....|..||.:|..:|..|||:..|:|||.:.:..|:..|..::||..|...|:.|.::|..
Mouse  3067 ILQSAANKKQLKDIETKILETLSSSEGNILEDESAIKVLDSAKIMSNEITKKQQVAEKTELKIAE 3131

  Fly  3743 AREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSIT 3807
            :||.|||.|:.:|:::|.:.||..|:|:||:||..|..::.|::..:..::.|:.|:..|.|..|
Mouse  3132 SREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNRSKILEKRLRYLNDHFT 3196

  Fly  3808 FCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFT--------- 3863
            :..:....|.|||:|||:|...||..:|:...|:|..||.|||        |...:         
Mouse  3197 YNLYCNICRSLFEKDKLLFSFLLCANLLLAKKEIEYQELMFLL--------TGGVSLKSAEKNPD 3253

  Fly  3864 --WLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEW-KGKSAIQRLCI 3925
              ||....|..|...:...||.||.:........|::..||:.|.|.|||... |..:.:|::.|
Mouse  3254 PDWLQDKSWEEICRASELPVFHGLREHFCNYIYLWEEIYDSKEPHNMKFPEPMDKTLNELQKIII 3318

  Fly  3926 MRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGK 3990
            :||:|||:::.|:.:::.:|||.|:::....:.::::.:|:....:.||||||.||:..:.|...
Mouse  3319 LRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLVFVLSPGADPMASLLKFAN 3383

  Fly  3991 SLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNV 4054
            ..  |.....|.::||||||..||...|..|.:.|.||.|||.||...|:|:|||..|. |....
Mouse  3384 DK--SMSGNKFQAISLGQGQGPVASKMITAAIEEGTWVCLQNCHLAVSWMPTLEKICEDFSPETC 3446

  Fly  4055 HTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKAL--DNFSD-ETLEMC-SK 4115
            :.::||:|::.|:..     .|..||::.:|:|||||||:..|:.::.  |..|| :..:.| .|
Mouse  3447 NPTFRLWLTSYPSPK-----FPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDTQFFKGCPGK 3506

  Fly  4116 ETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYL 4180
            |..::.:||.:|:|||:|.||:||||.|||..|.||..||.|||..|..::.....:|:|.:.||
Mouse  3507 ELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISVRQLQLFINEYDTIPFEAISYL 3571

  Fly  4181 FGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDG---ELEYCQGFPAPGILKYTGYHNYIDDNLP 4242
            .||..|||.:||||||||..|.|.:|....:|:.   :......:.||....|..|..:| ..||
Mouse  3572 TGECNYGGRVTDDWDRRLLLTMLADFYNSFIIENPHYKFSPSGNYYAPPKGTYDDYIEFI-KKLP 3635

  Fly  4243 -SESPSLYGLHSNAEIGFLTTVSERL--FRIVFE-LQPRMTGGSSGGETVSQEDIIKNIIEDILD 4303
             ::.|.::|||.|.:|      |:.|  .:::|| |.....|....|.:.|.:.::..|.||||.
Mouse  3636 FTQEPEIFGLHENVDI------SKDLQQTKVLFESLLLTQGGAKQTGSSGSTDQVLLEITEDILT 3694

  Fly  4304 KTPTPFNILELMG----RVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVME 4364
            :.|..|:|...:.    |.|:....::|  ||.||.|||:..::.:|.:|...:||.:.:.|.:|
Mouse  3695 QLPNDFDIEAALKNYPVRYEESMNTVLV--QEMERFNNLIRTIRNTLRDLKKAIKGLVVMDSALE 3757

  Fly  4365 DLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLL 4429
            .|...|.:.:|||.|.|.:|||:..|.|:.:|.:.||:.||.|.:..: ||..|::|||..|:.|
Mouse  3758 ALSGSLLIGKVPEMWAKRSYPSLKPLGSYITDFLARLKFLEDWFSSGK-PSVFWISGFFFTQAFL 3821

  Fly  4430 TAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLK 4494
            |..||..|||...|:|.:....:|..  .:...|.|.:|.||:||:::|||||...|.:|:.:.|
Mouse  3822 TGAMQNFARKYTIPIDLLGYEFEVIP--FDYSDTPPEDGVYIHGLYLDGARWDRFSGLLAEQYPK 3884

  Fly  4495 ELFPAMPVLYIKAVTQDKQDIKNV--YECPVYKIRLRGPT---------FVWTFNLKSRERASKW 4548
            .||..||:::||  ...|.:|..:  |.||:||...|..|         ||....||:.:....|
Mouse  3885 LLFDLMPIIWIK--PNLKIEIVKIEAYICPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTQHW 3947

  Fly  4549 TLAGVCLLLQ 4558
            ...||.||.|
Mouse  3948 IKRGVALLCQ 3957

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 6/39 (15%)
DHC_N2 1368..1770 CDD:285579 126/446 (28%)
P-loop_NTPase 1903..2132 CDD:304359 138/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 56/142 (39%)
P-loop_NTPase 2510..2783 CDD:304359 92/279 (33%)
P-loop_NTPase 2860..3127 CDD:304359 102/276 (37%)
MT 3140..3480 CDD:289543 108/352 (31%)
AAA_9 3509..3722 CDD:289547 92/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 249/713 (35%)
Dnah12NP_001357813.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.