DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and Dnah5

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:NP_579943.3 Gene:Dnah5 MGIID:107718 Length:4621 Species:Mus musculus

Alignment Length:4865 Identity:1405/4866 (29%)
Similarity:2373/4866 (49%) Gaps:578/4866 (12%)


  Fly     1 MADEKE-KKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTI-- 62
            :.:||| |:..:|.|.::.:..:...  |.|:|       .|..|.::|. |...:...:|.:  
Mouse    22 LKEEKEAKRARLDGRHDYLFAIVASC--LDLNK-------PEVEDALLEG-NQIERMDQLFAVGG 76

  Fly    63 -------------------NSGGQLYPSYSFPVRPRYKV------------AYFIR-----YLTP 91
                               .|.|.:.|:.....:|:..|            .:|||     .:||
Mouse    77 LRHLMFYYQDVEGAEAGHCGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITP 141

  Fly    92 LHLTDENMLNSLLIGDLLPNPLAN-LSILCDEVFFPLLNNTVNQVGWTNVIA-NDMKTESQEMRN 154
            .::..|...|:|   |.....|.| :..|..::|.|.|.  .:..||..:.. .|..:..||..:
Mouse   142 ENIHREVSFNTL---DTADGGLLNSVRRLLSDIFIPALR--ASSHGWGELEGLQDASSIRQEFLS 201

  Fly   155 GIAQMKGLV----------INRTIFPLPIC----MDEVMQAAPAIAMGDISVVNPLMKHSLEFMV 205
            .:....|::          :|     |..|    :..:.:....:|:..    ||.....:|..:
Mouse   202 SLEGFVGILSGAQNSLKEKVN-----LQKCDIIELKSLKEPTDYLALAS----NPETVEKVECCM 257

  Fly   206 VKWLDSVEDLVNIKAGEKIYSKENFPL--------PEAIFSFWESRLENLENLAEQLGDRRIKTI 262
            ..|:..:|.::          .||..|        |.|....|:.||.....|.:||....:|..
Mouse   258 RVWIKQMEQIL----------AENSQLRKEADDVGPRAELEHWKQRLSRFNYLLDQLKSPDVKAA 312

  Fly   263 GFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTI 327
            ..:|...:|.....:|.....:.::..||:|..|.|..|::..|...::|.......|..|:..|
Mouse   313 LALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMIDAIPTLINAI 377

  Fly   328 GLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPD---SIFQGDVDEAYKKLDINMQHLEYY 389
            .:|:..|.|::|...:|..|....|.:|......:..:   :|:....:...:|:...::..:.|
Mouse   378 KMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQGY 442

  Fly   390 KLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMG 454
            :..:.|.:..||:     ..:.:.:.:.:..|||:.:.|..||.::.|:|.|.:.:..|:...:.
Mouse   443 QSCFQETKQKLKQ-----NPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIE 502

  Fly   455 GL-----KGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDV----M 510
            ||     |.:.|..|::|  :|||.:              |.....|.:|...|..:.:.    :
Mouse   503 GLEDMATKYQDIVAAIKK--KEYNFL--------------DQREMDFDQDYEEFCKRINELHNDL 551

  Fly   511 ERMVSFQFEKGLEDTHDLLLAGSLLLRPIIKKH---------VEPLMHVIVDDFEEEIMCVKKEF 566
            :|.:...||| :..|...|        ..:||.         :|....:|..:|..:|..:.|.:
Mouse   552 QRFMDITFEK-IPSTRQAL--------STLKKFERLNIPNLGIEEKYQIIFQNFATDIDTISKLY 607

  Fly   567 INFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRI---IGLHKEHELYEYPLFDNERGGYVS 628
            ...| ....|..|:       |.::|.|.:.::|.||:   :.|.::|..    :........|.
Mouse   608 TKQK-YDPPLARNQ-------PPIAGKILWARQLFHRLEQPMQLFQQHPF----VLRTAEAKPVI 660

  Fly   629 DIFNIMVQEIDDFTKMLLDKW---TVECWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIK 690
            ..:|.:.:.:.:|..:....|   ..|...|::..:   |::.....||.|||..:::...::.:
Mouse   661 RSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASL---LVKAPGTGELFVNFDPQILVLFRETQ 722

  Fly   691 VVRLLGCDVSVNLTKFFCREDELWQ--ARVKLMRIAEWYNDTFERAH----PTEKRLIAAEMILI 749
            .:..||..||......|.:.|...:  :.:|:| ::|     :||..    |..::|:...:..:
Mouse   723 CMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMM-LSE-----YERVKLKMPPAIEQLMFPHLARV 781

  Fly   750 EEQMKPLLDFIKW----------NAFSQRFIVMIFKMVKYLHDRLVAAQE-NLEAIKESIRSWGK 803
            :|.::|.|..:.|          |||::      .|.::.|.||:....| .:.||.|.:.|...
Mouse   782 DEALQPGLAVLTWTSLNIGGYLENAFAK------IKDLELLLDRVNDLIEFRIHAILEEMSSMAL 840

  Fly   804 VPLFQ------------RKDL--NPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFD 854
            ..|.|            .|||  :.|.|||.   :..|...|.|     .||::|:.|      |
Mouse   841 CQLPQDDPLTCEEFLQMTKDLCVSGAQLLHF---KSSLVEEAVN-----ELINMLLDV------D 891

  Fly   855 IP---------RRYSLPPGE-HGEEDEESDGIWPPI----ISLSVMTSVKFKKKREVIDEEDD-L 904
            :|         ...:.|.|. .|..:..|:.:....    .||.:..:.:.||:.||::|..: |
Mouse   892 VPPEEAAENVCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEARELL 956

  Fly   905 EEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEV 969
            ..|..:.:::            |||.......|:.|  .|:...:|  |..||         .:.
Mouse   957 SHFNHQNTDA------------LLKVTRNTLEAIRR--RIHFSHMI--NFRDS---------NDA 996

  Fly   970 DNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKT-------------GFAFFIETIL-------- 1013
            ....:|:.|||...:.|..||:.....|:...:|             |...:...:|        
Mouse   997 SKAKQNHLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHER 1061

  Fly  1014 --------DDMNNMMSLLKRVAQDPTEVTNMN------PYSFYDELQDKSELDKQRVEIMNKIKL 1064
                    :|.::...:.:...|:..|:.::|      ..::|..:.|..|:.|....:...|..
Mouse  1062 KMAAVKNNEDSDSDAEVEENELQETLEIASINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISS 1126

  Fly  1065 ALQAVRVHGKGFMEFSSLWIWDKS----TYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEY 1125
            ..:.|......|..::.:|..:|.    |::::      |..|.|.::..               
Mouse  1127 TKKEVITSMDRFKRYNHIWQKEKEDTIMTFIAQ------NPLLPEFESRI--------------- 1170

  Fly  1126 PPLSVYKEQLDKFIELQ-DQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVK 1189
                :|.:.|::.|..: :.||...        :.|.....|:::.::...|:::.......:.:
Mouse  1171 ----LYFQSLEQEINAEPEYIRVGS--------IALYTADLKLSLTAETKAWMAVIGRHCNRKYR 1223

  Fly  1190 NSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNY 1254
            ..::.:...|:|:.  .|:.....|.:.:...::.|.:|.|:|...|....|::|...||.:|..
Mouse  1224 AEMENILTVVEESQ--KKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGL 1286

  Fly  1255 EFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSK-K 1318
            .....|:.:::.|..||.|:...|:..:..:..:|.                  ::||:.:|. :
Mouse  1287 LVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQP------------------SFRKELISTVE 1333

  Fly  1319 FFFVPCLSCYELID------------ESDLELVALEERQRSLAESAVLF----ELQG----PDPV 1363
            .|...|...|...|            |:...|:..:.:..::....:.:    ||.|    |.|.
Mouse  1334 VFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQ 1398

  Fly  1364 KIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEP 1428
            .:|:.| .|.|::.::.....:..|:|.::.|.|..::||.::.|..:|....|.|.:|::.|:.
Mouse  1399 LLEIKR-QLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQA 1462

  Fly  1429 FIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDST-TLKDLIDLNLHEYEEE 1492
            |:.::.::.:.......:..:.:.|:.:|||..:...|.....:.:.| .|:::::..|.:|:||
Mouse  1463 FLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEE 1527

  Fly  1493 VKNIVDKSVKEMAMEKQLRDIATAWG--TMEFGTDIHDRTSIKLL---KASEELIETLEDHQGQL 1552
            :::|...:|||..:|::||.:...|.  |:.|.   ..:|..:||   .::.|:|.::||....|
Mouse  1528 IEDICISAVKERDIEQKLRQVINEWDNKTLTFS---GFKTRGELLLRGDSTSEVIASMEDSLMLL 1589

  Fly  1553 QNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFD 1617
            .::.|::|...|:.:::.|...|||:..||.:|..||..|.|||::|:|. ||..|||::::||.
Mouse  1590 GSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGG-DIAKQLPKEAKRFS 1653

  Fly  1618 YIDKEFKALLAQMNADRNVVRST--NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFY 1680
            .|||.:..::.:.:...|||:..  :.:..:|..|   ||..|.:|:|:|..|||.|||.:|||:
Mouse  1654 NIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPH---LLDQLEICQKSLTGYLEKKRLCFPRFF 1715

  Fly  1681 FVSSADLLDILSNGNNPALVARHLTKLYDSMGKL--------NLISGSKNAAGMVAKELEEYVPF 1737
            |||...||:||...::...:..||..::|::..:        .::|.|......:  ||::.|. 
Mouse  1716 FVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETI--ELDKPVM- 1777

  Fly  1738 LENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHV--WIFEWPAQPALVGTQIMWTT 1800
                 ..|.||||||.:.::.:.:|...::::..........:  ::..:|||..|:|.|::||.
Mouse  1778 -----AEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTR 1837

  Fly  1801 ETNDAF--AKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGT 1863
            ::.:|.  ||..::   .::..|:..:..||.||.:...||::.||.|..|:.||.||.||:...
Mouse  1838 DSEEALRNAKFDKK---IMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDD 1899

  Fly  1864 IIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLT 1928
            :....|:..|.|:|..|.|..:....|....:|.|..|.|..|:||.|.|||||||||||||||.
Mouse  1900 LCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLA 1964

  Fly  1929 QSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFD 1993
            |:|.:.|||||||||||||||||||:||.||..|.|||||:|||::.:|.|.|||||:|:|||||
Mouse  1965 QALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFD 2029

  Fly  1994 EFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFL-GEHIALRTTVGVFITMNPGYAGRAELPENL 2057
            |||||.:.||||.|.|:..|....|..|::|.|. |:::.:....|:|:|||||||||.||||||
Mouse  2030 EFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENL 2094

  Fly  2058 KALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVL 2122
            |..:|..||:|||..:|..:.|.:.||.:..:|||||.|||.||:|.||||.|||:|||.|.|||
Mouse  2095 KINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVL 2159

  Fly  2123 VVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIK 2187
            ...||.:|......|..::||.|||.|:.|::.:|.|:|:.||.||||.:.:.:...||.|..|.
Mouse  2160 RTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAIS 2224

  Fly  2188 RSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYN-DL 2251
            :...:..|.....:.||::||.|...|||.:..:|.:|:||:....||.|. .....|||.. .:
Mouse  2225 KQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKA-MTDCGKPHREMRM 2288

  Fly  2252 NPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDN 2316
            ||||:|..::||.::.:|.:|.||:||.|.|...........||||||.:|.:|||:||:|:|||
Mouse  2289 NPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDN 2353

  Fly  2317 KVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSE 2381
            |.||||:.:||.:....:::||..::..|:||||||.|:::::...|.|:|.::.:| .|.:..|
Mouse  2354 KTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFL-KRRSPQE 2417

  Fly  2382 VSMLNVLFDKYVPPLLDIFRTRLRSI---TPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEI 2443
            ..:|..|:.:..|   |::|..::::   ..:.:...:..:.::|..::.|:....:...:....
Mouse  2418 AEILRQLYAETFP---DLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQAGEVDPEHLGR 2479

  Fly  2444 YFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLN-EYKAVKFP----LSGTIFSFYI-DHETKKFFP 2502
            .|||.::|..|:.|    .::.......|..: |...:..|    ...|:|.:|: .:.|.:.  
Mouse  2480 LFVFAMMWSVGAVL----ELEGRRRMELWLRSREGPTLHLPQLTDAGDTMFDYYVAPNGTWRH-- 2538

  Fly  2503 WTNLVPQFELDMDLPLQ--SNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSA 2565
            |:...|::....|...:  |.||...:..|..|.:.|:.:....::|||..|:.||:::...:|.
Mouse  2539 WSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSK 2603

  Fly  2566 LPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQ 2630
            ...:.:.|.|:.|:..||..|.||.:|..::|:.|..|||...|:|..|:||:|||.::::....
Mouse  2604 FDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQV 2668

  Fly  2631 PHTLIRQFMDYHHWYDRQK----MTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPP-- 2689
            .:.::||.|:...:|:.:|    .::.||.  .:.|.::|..|...|..||:|.|..|....|  
Mouse  2669 TNEIVRQLMEQSGFYNLEKPGEFTSIVDIQ--FLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSD 2731

  Fly  2690 -SQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLR 2753
             |.|.:|.::.:..........::...|:|||..  :|..:....|:  ..|||..||||.||||
Mouse  2732 ASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVP--LTRRLWQMTKL--KMLPTPAKFHYVFNLR 2792

  Fly  2754 DIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRK--GIEGV 2816
            |::.|:.|:|...||...::::::|||.|||.||..|:....:|:..|.|.|..:|.:  |.|  
Mouse  2793 DLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE-- 2855

  Fly  2817 NDDVVYAQPLIYC----HFAKGLTDIK-----------------YMPISGWDRLKSLLDEAQDRY 2860
                  ..|::.|    :|...|.|..                 |.||:..:.|:..|......|
Mouse  2856 ------KAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLY 2914

  Fly  2861 NDYI--GAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQL 2923
            |:.|  ..|::|.|.|||.|:.:|||::.:.||.|||:|||||||||||||||||:....|||.|
Mouse  2915 NESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITL 2979

  Fly  2924 TKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVEN 2988
            |:.|:.|:|..::..||..||.:.....|:.||:|:..|.||..:|::|:||::..||..||::.
Mouse  2980 TRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDE 3044

  Fly  2989 IVNAVRNEVKQLGIVDN------RENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNC 3047
            |.:.:...:|:    ::      .:|.::||:.:||..|.:||||||||...|.|:.|||||::.
Mouse  3045 INSDLTPIMKK----EHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISG 3105

  Fly  3048 TTIDWFHEWPQQALESVSLRFLSEITV-----LPKELALPVSNFMAFVHKTVNDISKLYLANAKR 3107
            .|||||..||:.||.:||..|||..|:     :.|||...:.:|...|.:...|    |....:|
Mouse  3106 CTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCAD----YFQRFRR 3166

  Fly  3108 YNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIK 3172
            ..:.||||:|..|..|..:..||.........|:..||.||...::.|.||...|..:|.||::.
Mouse  3167 STHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVA 3231

  Fly  3173 NQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALN 3237
            |::||.::..|..:.:...|.:|...|.:...:.|.:.::....:.||....|:|||..|:.||.
Mouse  3232 NEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQ 3296

  Fly  3238 TLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK---GKIPKDR-----SWKACRAFM--GNVDK 3292
            |:..:::..:::.|.||..::.:...||:||..:   .||..|:     ||:.....|  ||   
Mouse  3297 TIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGN--- 3358

  Fly  3293 FLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPK 3357
            ||.||..:.|..|:.:||:.|.||...::::.|.........||||||...:..|:.:...|.|.
Mouse  3359 FLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPL 3423

  Fly  3358 ERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANR 3422
            :..|:..|.....|...|......|...:.:|:.:|.||::|:|:||...::|.:....:..|:.
Mouse  3424 KANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTAST 3488

  Fly  3423 LIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQP 3487
            ||.|||.||.||.|..|......::|.||:|:.:.|:||.|.|.:.:|..|... |....|..: 
Mouse  3489 LISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHD-WKKEMKARK- 3551

  Fly  3488 PIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKY 3552
             ||..:|::..||:.|...|:|||.||||:|.:|.:|..|:.::.||||:||||.||..|:|.|.
Mouse  3552 -IPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKE 3615

  Fly  3553 GTG-LVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDRE 3614
            ... |.:..|:.:.:.:.:|.::|.|..||||::||.:||.|:.:|.:..||.|:.  :|:||:|
Mouse  3616 SQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKE 3680

  Fly  3615 IDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQ 3679
            :|....|:|.:.|||.||.|.||:.|:|::|:||||..|||||||..|:..|:.:||..||.|.:
Mouse  3681 VDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLE 3745

  Fly  3680 QQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAR 3744
            .....|..:|.|||:||.||:|...:::||.:|::.|..|||||:|:..|:..:..|.:||:|||
Mouse  3746 DVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAR 3810

  Fly  3745 EAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFC 3809
            |.|||.|.|.||:||::.::..:|.:||.||:.|..:|:.::.:::.:.....|:.|:|:.:|:.
Mouse  3811 EEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYE 3875

  Fly  3810 SFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR---------FPYMPNQTSNFTWL 3865
            .|.|.:|||:|:.|.:|...|.::|.:....|:..|...|::         .|..|::     |:
Mouse  3876 VFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSK-----WI 3935

  Fly  3866 THVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEW-KGKSAIQRLCIMRCI 3929
            ..:.|..:..|:....|..:...|..:.|.|:.:.|.|:||.|..|..: |.....:||.::|..
Mouse  3936 LDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSW 4000

  Fly  3930 RPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGF 3994
            .|||.....|.:|.:.:|..|.:...::..:|:|||.|.|.:..:||.|.||...:..|||.|..
Mouse  4001 CPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKI 4065

  Fly  3995 SFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKME--SSLSNVHTS 4057
            ...:     ||:|||||:.|...:......|.||:|||.||   .|..|::.|:  :....||.:
Mouse  4066 ETRY-----VSMGQGQEVHARKLLHQTMANGGWVLLQNCHL---GLDFLDELMDVVTETETVHDT 4122

  Fly  4058 YRLFLSAEPAGDPAAH-ILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKA 4121
            :||:::.|      .| ..|..:|:.:||..||||.|:.|.:.:.....|.:.|:: |...::|.
Mouse  4123 FRLWITTE------VHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDV-SVGAQWKP 4180

  Fly  4122 ILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL---EANTRVPWEDLRYLFGE 4183
            :|:::.:.|:.|.|||||||.|||..|.||..|...:|..:.|:|   :....|.|..:||:.||
Mouse  4181 MLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGE 4245

  Fly  4184 IMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPS-ESPS 4247
            |.|||.:|||:|:||..|:.:.:....:...:..:.||:..|......||..|| .:||: :||.
Mouse  4246 IQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYI-QSLPAYDSPE 4309

  Fly  4248 LYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTP---TPF 4309
            ::|||.||:|.:.:.:::.:...:..:||:   .||||...::|.::..:.:|:|:|.|   :||
Mouse  4310 VFGLHPNADITYQSKLAKDVLDTILGIQPK---DSSGGGDETREAVVARLADDMLEKLPEDYSPF 4371

  Fly  4310 NILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQ 4374
            .:.|.:.::....|..|...||.:||..:::.::.:|.||.|.:.|.:.:|..:.|.:.|::..:
Mouse  4372 EVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDAR 4436

  Fly  4375 VPEQWTKLAY-PSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTAR 4438
            :|.:|.|.:: .|.||.  ||::|:.|..:...||::.| |...|:.||||||..|||:.|:..|
Mouse  4437 IPARWKKASWVSSTLGF--WFTELLERNCQFTSWVSNGR-PHCFWMTGFFNPQGFLTAMRQEITR 4498

  Fly  4439 KNE-WPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPV 4502
            .|: |.||.|.|..:|||..|::::..|.||.|:.||::|||.||.:...:.::..|.||..|||
Mouse  4499 ANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPV 4563

  Fly  4503 LYIKAVTQDKQDIKNVYECPVYKIRLRGP-TFVWTFNLKSRERASKWTLAGVCLL 4556
            :.|.|.....:| ..:|.||:||..:|.. .::...:||:.:....|.|.||.||
Mouse  4564 IRIFAENNTARD-PRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALL 4617

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 119/617 (19%)
DHC_N2 1368..1770 CDD:285579 116/418 (28%)
P-loop_NTPase 1903..2132 CDD:304359 140/230 (61%)
P-loop_NTPase 2217..2352 CDD:304359 56/136 (41%)
P-loop_NTPase 2510..2783 CDD:304359 83/282 (29%)
P-loop_NTPase 2860..3127 CDD:304359 115/280 (41%)
MT 3140..3480 CDD:289543 104/350 (30%)
AAA_9 3509..3722 CDD:289547 95/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 225/699 (32%)
Dnah5NP_579943.3 Stem. {ECO:0000250} 1..1938 444/2118 (21%)
DHC_N1 248..802 CDD:285571 119/615 (19%)
DHC_N2 1402..1804 CDD:285579 116/418 (28%)
P-loop_NTPase 1939..2170 CDD:304359 140/231 (61%)
AAA 1. {ECO:0000250} 1939..2161 137/222 (62%)
AAA 2. {ECO:0000250} 2221..2440 79/224 (35%)
P-loop_NTPase 2254..2389 CDD:304359 56/136 (41%)
AAA 3. {ECO:0000250} 2547..2800 75/259 (29%)
P-loop_NTPase 2558..2822 CDD:304359 82/270 (30%)
AAA 4. {ECO:0000250} 2913..3167 108/262 (41%)
P-loop_NTPase 2914..3183 CDD:304359 115/277 (42%)
Stalk. {ECO:0000250} 3182..3479 83/300 (28%)
MT 3199..3543 CDD:289543 103/348 (30%)
AAA 5. {ECO:0000250} 3564..3794 100/230 (43%)
AAA_9 3572..3788 CDD:289547 95/216 (44%)
Dynein_heavy 3929..4610 CDD:281078 226/709 (32%)
AAA 6. {ECO:0000250} 4009..4223 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.