DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah5

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_021322524.1 Gene:dnah5 ZFINID:ZDB-GENE-110411-177 Length:4639 Species:Danio rerio

Alignment Length:4740 Identity:1365/4741 (29%)
Similarity:2316/4741 (49%) Gaps:505/4741 (11%)


  Fly    84 YFIRYLTPLHLTDE--------NMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNV 140
            :|.|..|...:|.|        |||::..:|     .|.::..|..|:|.|.|...  ..||..:
Zfish   134 FFTRANTSKPITSENIHRDVNFNMLDTTGVG-----LLKSVEQLLSEIFIPTLRKM--NYGWGEL 191

  Fly   141 IANDMKTESQEMRNGI-------------AQMKGLVINRTIFPL-----PICMDEVMQAAPAIAM 187
            .:...:...|:..:.:             .|.|..:.....|.|     |.....|..:|.|:  
Zfish   192 ASPQAQAVKQDFISSLDSFVSVLSGAQESLQEKVNLQECETFDLKTLKGPSDYTAVANSADAL-- 254

  Fly   188 GDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPL-PEAIFSFWESRLENLENLA 251
                       ..:|..:..|:..:|.::   |......||...| |.|....|:.|:.....|.
Zfish   255 -----------EKIEACMKTWIKQIEQVL---AESDQLRKEADDLGPRAELDHWKKRMSRFNYLL 305

  Fly   252 EQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDEN 316
            :||....:|.:..||...:|.....:|.:...:.::..||:|..|.|..|::..|....::....
Zfish   306 DQLKSPEVKAVLGVLLVAKSKLIKVWRELDIRITDAANEAKDNVKYLYTLEKFCDPLYNSNPVSM 370

  Fly   317 RSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTV----------EPDSIFQGD 371
            ...|..|:..|.::...|||::|...:|..|....|.:|......:          :|..:    
Zfish   371 VEAIPGLINAIRMIHSISRYYNTSEKITSLFVKVTNQMITACKAYITNNGSATIWDQPQEV---- 431

  Fly   372 VDEAYK-KLDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEEL 435
            |.|..| .:.:|.::.:|::         ..|.|:....:.:.:.:.:..|||:.|.|..||.::
Zfish   432 VSEKLKAAIRLNQEYQKYFQ---------KTKQKLEENPSERQFDFSEMYIFGKFDTFQRRLSKI 487

  Fly   436 KDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDR 500
            .:||:|:..:..|:...:.|         ||.:...:.:|.......||:.:  |...:.|.:|.
Zfish   488 LNLFSTITTYNALQDSKIEG---------LETMATRFQAIVLTMKKKQYSFL--DQRRTDFDQDY 541

  Fly   501 LSF-KAKTDVMERMVSFQ---FEKGLEDTHDLLLAGSLLLRPIIKKH---------VEPLMHVIV 552
            ..| |..:::..::.:|.   |:| :::|...|.        ::||.         :......|:
Zfish   542 EEFCKQTSELHNQLKTFMDNTFDK-IQNTERALY--------VLKKFERLGIPDLGISDKYQRIL 597

  Fly   553 DDFEEEIMCVKKEFINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEY- 616
            .:|..:|..:.:.:...|        .:.|.....|..:|.|.:.::|..||   .:..:|::. 
Zfish   598 QNFGRDIEMISRIYNKQK--------TDPPIAPDLPPTAGKILWARQLYSRI---QEPMDLFQQL 651

  Fly   617 ----------PLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKW---TVECWQGIQQDITLTLIEK 668
                      |:..|         :|.:.:.:.:|..:....|   |.....|:|..:   |::.
Zfish   652 PGLLSTPDAKPIIRN---------YNRVAKVLLEFEVLYHHSWMAQTEAVKAGLQASL---LVKS 704

  Fly   669 DEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARV-KLMRIAEWYNDTFE 732
            .|..:|.|||..:::..:::...:..:|.|:. .......::.|:::... ||..:....:....
Zfish   705 PETGQLFVNFDPQILTQIRETDCMLGMGLDIP-PFAAILQQKKEVFKKNYNKLQLMVTRNSGVRS 768

  Fly   733 RAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKES 797
            :.....::|:...:..::|.:.|.|..:.|.:.:         :.||| .|:.||.:|||.:...
Zfish   769 KIQAAFEQLLMPHVAKVDEAILPGLTSLNWTSLN---------IDKYL-CRITAALDNLELLLHR 823

  Fly   798 IRSWGKVPL-FQRKDLNPALLLHTDPREPI-----------LSIRAANAADTQ---------RLI 841
            :....:..: ...::::.|.|......||.           |.|:.|....|:         .||
Zfish   824 VNDLVEFRIDAVLQEMSTATLCVLPEDEPCTCEEFVQTTKELCIKGAQMLHTKSSLVEEAANELI 888

  Fly   842 DLLMYVNLKLFFDIPRRYSLPPG--EHGEEDEE---SDGIWPPIISLSVM------TSVKFKKKR 895
            ::|:.:..|...|..|..|....  |..|.|||   |||   .:.|.|.|      :|...:||:
Zfish   889 NMLLELEQKEEDDRNRDDSRTESKVEQMESDEEECKSDG---RLFSRSTMAPSLGPSSPLLRKKK 950

  Fly   896 EVIDEEDDLEEFEEEQSESEEEIITPF-HR-YELLKGLSQEERALFREYEIYVDEIIAENLVDSV 958
            ::     ||.:..||::   :|:::.| || .:.|..|::......|:      .|.|.:|:..:
Zfish   951 KL-----DLMKVMEEEA---KELLSHFNHRNVDALLRLTRNTLETLRK------RIHASSLMHFL 1001

  Fly   959 ITSSTYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLD-------------TSSKTGFAFFIE 1010
            ..:.:..|    .:.....|||...:.|..||::....||             .|...|...:.:
Zfish  1002 AEADSPSR----QKGSGPQPIFRAGVCLAIPNIIMVPGLDEVQHALNRAVDYVVSVSKGVGQWSK 1062

  Fly  1011 TILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELD----------------------- 1052
            ..:.........:..:.|:..|..:.:..|.|....:.|..|                       
Zfish  1063 ERISKRKMSERRMAALKQNSQESESEDADSTYHSFAEGSTSDISASANQAIPFQIKNYHKSISEN 1127

  Fly  1053 KQRVEIMNKIKLALQAVRVHGKGFMEFSSLW--IWDKSTYLSEVKKFGRNLTLDERDAEADLEGS 1115
            |:.|::::.:..::.:.:......:|..|::  ||.|... ..::||              ::|:
Zfish  1128 KEIVKLVSVLSTSINSTKKEIMNALERFSIYHHIWKKDRE-ETIQKF--------------IQGN 1177

  Fly  1116 SGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFV---FLRLNMTGFKVAVLSQVGQWI 1177
                      |.||.::.|:..:.:|:.:|..    |..|:   .|.|.....|:|:.::...|:
Zfish  1178 ----------PFLSEFESQILYYRDLELEINA----EPEFISVGALALYTVDLKLALTAETKSWM 1228

  Fly  1178 SLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPL 1242
            ..|......:.:..::::..|:|||:  .|:..|..|.:.:...::.|.:|.|.|...|....|:
Zfish  1229 VDFGQYCNRKYRMEMEQIFTFIDEAS--KKLNRQIKDLDDIRIAMATLKEIREHQISIDFQVGPI 1291

  Fly  1243 KEIIDLLRQYNYEFKDTELAQINELPDAWMK-VKRLAATTKQLIAPIQSYQVDLI---EKRILLC 1303
            :|...:|.:|.......|..:::.|...|.| :.|......:|::....::.:||   |..:..|
Zfish  1292 EESYSMLHKYGLLIAKEEAEKVDTLRYTWEKLLSRSTEVQNELVSLQPKFRGELIKNVETFVEDC 1356

  Fly  1304 DNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLF----ELQG----P 1360
            .:..:.|.:.        .|.:......|.|| .|:..:.|..:|....:.|    ||.|    .
Zfish  1357 QHFYHDYDRD--------GPMVVGLAPQDASD-RLIMFQNRFDNLFRKYITFTGGEELFGLPVTQ 1412

  Fly  1361 DPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRT 1425
            .|..:|: |..|.|::.::....::..|:|.:....|..|.|:.::.|...|....|.|.:.::.
Zfish  1413 HPQLLEI-RKQLTLLQKLYGLYNSVIDTVNGYYDISWADIHIDRINNELLDFQARCRKLPRGLKE 1476

  Fly  1426 WEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEY 1489
            |:.|:.::.::.........:..:.|.|:..|||..:.:.|...|.:: |:..|:::::..|.:|
Zfish  1477 WQAFMDLKKTIDEFSECCPLLDLMTNKAMMTRHWKRITEVTGHTFEVETDNFKLRNIMEAPLLKY 1541

  Fly  1490 EEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLL---KASEELIETLEDHQGQ 1551
            :||:::|...:|||..:|::|:.:...|....| |....:|..:||   .::.|:|..:||....
Zfish  1542 KEEIEDICISAVKERDIEQKLKQVIAEWDNKTF-TFAQFKTRGELLLRGDSTSEIITNMEDSLMV 1605

  Fly  1552 LQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRF 1616
            |.::.|::|...|:.:::.|...|||...||.:|..||..|.|||::|:|. ||..|||::::||
Zfish  1606 LGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGG-DIAKQLPKEAKRF 1669

  Fly  1617 DYIDKEFKALLAQMNADRNVVRST--NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRF 1679
            ..|||.:..::.:.:...|||:|.  :.:..:|..|   ||:.|.:|:|:|..|||.|||.:|||
Zfish  1670 SNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPH---LLEQLEMCQKSLTGYLEKKRLLFPRF 1731

  Fly  1680 YFVSSADLLDILSNGNNPALVARHLTKLYDSM----------GKLNLISGSKNAAGMVAKELEEY 1734
            :|||...||:||...::...:..||..::|::          .|:..||..:      .:.:|..
Zfish  1732 FFVSDPALLEILGQASDSHTIQAHLLNIFDNIKCVRFHEKMYDKILAISSRE------GETIELD 1790

  Fly  1735 VPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRS-----------LTFYDHKPRHVWIFEWPAQ 1788
            .|.:    ..|.||||||.:..:.:.:|...::::           :.|.|         .:|||
Zfish  1791 KPVI----AEGNVEVWLNALLKESQRSLHLVIRQAALAIQDSGFELIEFLD---------SFPAQ 1842

  Fly  1789 PALVGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICT 1852
            ..|:|.|::||.::.||.:..  ||: ..:...|:..:..|||||.:...||.|.||.|..|:.|
Zfish  1843 VGLLGIQMIWTKDSEDALSNA--RYDRKIMSKTNQFFLELLNNLIDMTTKDLGAVERTKYETLIT 1905

  Fly  1853 IDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVIT 1917
            |.||.||:...:....::..|.|:|..|.|..::...|....||.|..|.|..|:||.|.|||||
Zfish  1906 IHVHQRDIFDDLCRLHIKSPTDFEWLKQCRFYFNEDSDKMMINITDVGFVYQNEFLGCTDRLVIT 1970

  Fly  1918 PLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKG 1982
            ||||||||||.|:|.:.|||||||||||||||||||:||.||..|.|||||:|||::.:|.|.||
Zfish  1971 PLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKG 2035

  Fly  1983 LAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFL-GEHIALRTTVGVFITMNPG 2046
            |||:|:||||||||||.:.||||.|.|:..:....|.:::.|.|. |:::.:....|:|:|||||
Zfish  2036 LAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRKNFIFTDGDNVEMNPEFGIFLTMNPG 2100

  Fly  2047 YAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHY 2111
            ||||.|||||||..:|..||:|||..:|..:.|.:.||.:...|||||.|||.||:|.||||.||
Zfish  2101 YAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIELARKFFTLYKLCEEQLSKQVHY 2165

  Fly  2112 DWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPR 2176
            |:|||.|.|||...||.:|.:....|..::||.|||.|:.|::.:|.|:|:.||.||||.:.:.:
Zfish  2166 DFGLRNILSVLRTLGAAKRANPNDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDK 2230

  Fly  2177 KRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQN 2241
            ...|:.|:.|.:...:..|.....:.||::||.|...|||.:..:|.:|.||:....||.|. ..
Zfish  2231 AGYPDLESAIDKQVTEAGLINHPPWRLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKA-MT 2294

  Fly  2242 QKRKPHYN-DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMW 2305
            ...:||.. .:||||:|..::||.::.:|.:|.||:||.|.|...........||||||.:|.:|
Zfish  2295 DCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIW 2359

  Fly  2306 IESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQ 2370
            ||:||:|:|||:.||||:.:||.:....:::||..::..|:||||||.|:::::...|.|:|.::
Zfish  2360 IENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIENASPATVSRNGMVFMSSSVLNWSPILE 2424

  Fly  2371 SWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDI--ARLQMTCY-LLDSMLTPQNV 2432
            .||..| ::.|..:|..||....|   :::|..::|:....::  |.:.|.|. :|..::.|:..
Zfish  2425 GWLKNR-SAQEGMVLKDLFSSSFP---ELYRFSIQSLQYKMEMLEAFIIMQCINMLQGLIQPKEQ 2485

  Fly  2433 PNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPL-------SGTIFS 2490
            ..:..::..|..:||.::|..|:.|..|..:    :..:| |..:.::...|       ..|:|.
Zfish  2486 GGELSREHMERLYVFALMWSVGALLELDDRM----KLERW-LRNHDSIHLDLPNIPPHSEDTMFD 2545

  Fly  2491 FYIDHETKKFFPWTNLVPQFELDMDLPLQ--SNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGS 2553
            ||:.:: ..:..|...|.::....|...:  |.||...:..|..|.:.|:.:....::|||..|:
Zfish  2546 FYVTND-GHWVHWNTRVEEYIYPPDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGT 2609

  Fly  2554 GKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDM 2618
            .||:::...:|....:.::..::.|:..||..|.||.:|..::|:.|..|||...|:|..|:||:
Zfish  2610 AKTVIIKGYMSKYDPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDI 2674

  Fly  2619 NMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK----MTLRDIHKCNIVACMNPSAGSFTIDPRLQR 2679
            |||.::::.....:.::||.|:.:.:::.:|    ..:.||.  .:.|.::|..|...:..||:|
Zfish  2675 NMPVINEWGDQVTNEIVRQLMEQNGFFNLEKPGEFTNIVDIQ--FLAAMIHPGGGRNDVPQRLKR 2737

  Fly  2680 HFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAI 2744
            .|..|....||..::..|...|.:.|..:. :.|.:.|......:|.....|........|||..
Zfish  2738 QFSIFNCTLPSNASIDKIFGVIGTGHYCSH-RGFSEEVRNTVGRLVPLTRRLWQMTKVKMLPTPA 2801

  Fly  2745 KFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIV 2809
            .|||.|||||::.|:.|:|...:|.......:::||.|||.||..|:.....|:..|...::.:|
Zfish  2802 NFHYIFNLRDLSRIWQGMLGVTAEVISTPQLLLQLWKHECKRVIADRFTAPEDVAWFDSTLAKLV 2866

  Fly  2810 RKGIEGVNDDVVYAQPLIYCHFAKGLTDIK-----------------YMPISGWDRLKSLLDEAQ 2857
            .:.:.....:||...  :..:|...|.|..                 |.||..:|.|...|:...
Zfish  2867 EEQLGEEEREVVDLG--VDSYFVDFLRDAPEATGDEPEETDFDMPKVYEPIESFDSLMERLNMFL 2929

  Fly  2858 DRYNDYI--GAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQ 2920
            ..:|:.|  .:|::|.|.|||.|:.:||||:.:.||.|||:|||||||||||||||||:....||
Zfish  2930 SHFNESIRGASMDMVFFRDAMIHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQ 2994

  Fly  2921 IQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDE 2985
            |.||:.|:.::|..::..||..||.:.....|:.||:|:..|.||..:|::|:||::..||..||
Zfish  2995 ITLTRSYNTANLMEDLKGLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDE 3059

  Fly  2986 VENIVN----AVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVN 3046
            ::.|::    .::.|..:.  ....||..:||:.:||..|.|||||||||...|.|:.|||||::
Zfish  3060 IDEIISDLIPVMKREFPRR--PPTNENLHEYFMSRVRQNLHVVLCFSPVGERFRNRALKFPALIS 3122

  Fly  3047 CTTIDWFHEWPQQALESVSLRFLSEITV-----LPKELALPVSNFMAFVHKTVNDISKLYLANAK 3106
            ..|:|||..||:.||.:||..|||...:     :..|:...:.:|...|.:...|    |....:
Zfish  3123 GCTMDWFSRWPKDALIAVSEHFLSTYDIDCTLEVKSEVVQCMGSFQDGVAEKCAD----YFQRYR 3183

  Fly  3107 RYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKI 3171
            |..:.||||:|..|..|..:..||.........|:..||.||...::.|.||...|:|:|.||:|
Zfish  3184 RSTHVTPKSYLSFIHDYKTIYKEKHSEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQI 3248

  Fly  3172 KNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEAL 3236
            .|.:||.::..|..:.:...|.:....|.:...:.|.:.::|...:.||....|:|||..|:.||
Zfish  3249 ANAKADMVLKEVTVKAQAAEKVKVEVQKVKDKAQAIVDSISADKAIAEEKLEAARPALEEAEAAL 3313

  Fly  3237 NTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKD--------RSWKACRAFM--GNVD 3291
            .|:..:::..:::.|.||..::.:...||:||..:....|.        .||:.....|  ||  
Zfish  3314 QTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNTVKTDPEKNCTMPSWQESLKLMTAGN-- 3376

  Fly  3292 KFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEP 3356
             ||.:|..:.|..|:.:|::.|.||....:::.|.........||||||...:..|:.:...|.|
Zfish  3377 -FLGSLQQFPKDTINEEVVEFLSPYFDMVDYNIETAKRVCGNVAGLCSWTKAMAAFFSINKEVLP 3440

  Fly  3357 KERALLESEKEVKDARDKLTALNLRLTELEEQLNA-------LQMEYDEALAKKQKCQDEASKTA 3414
            .:..|...|       ::||..||.|.:.:.:|:|       :|.||::|:.:||...::|.:..
Zfish  3441 LKANLAVQE-------NRLTIANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDAERCR 3498

  Fly  3415 FTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWM 3479
            ..:..|:.||.|||.||.||.:..|......::|.||:|:.:.|:||.|.|.:.:|..|... |.
Zfish  3499 HKMQTASSLISGLAGEKERWTQLSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLTD-WQ 3562

  Fly  3480 PAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQG 3544
            ...|..|  ||....::..||:.|...::|||.||||:|.:|.:|..|:.::.|:||:||||.||
Zfish  3563 REMKFRQ--IPFRTNLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQG 3625

  Fly  3545 IKWVKTKYGTG-LVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV- 3607
            ..|:|.|.... |.:..|:.:.:.:.:|.::|.|..||||::||.:||.|:.:|.:..||.|.. 
Zfish  3626 KIWIKNKESKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGFTY 3690

  Fly  3608 -LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLE 3671
             :||||:|:|....|||.:.|||.||.|.||:.|:|::|:||||..|||||||..|:..|:.:||
Zfish  3691 KVKIGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELE 3755

  Fly  3672 AMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKIT 3736
            ..||.|.:.....|..:|.|||:||.||:|...::::|.:|:..|..||:||:|:..|:..|..|
Zfish  3756 KERTDLLEDVTANKRKMKELEDNLLFRLTSTQGSLVDDESLITVLGNTKRTAEEVTQKLQIAAET 3820

  Fly  3737 GVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVEN 3801
            .:||::|||.|||.|.|.||:||::.::..:|.:||.||:.|..:|:.::.|:..:.....|:.|
Zfish  3821 EIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLTKSSKSPITSKRIAN 3885

  Fly  3802 LIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR------FPYMPNQTS 3860
            :|:.:||....|.:|||:|:.|.:|...|.::|.:....|:..|...|::      ....|.:.:
Zfish  3886 IIEYMTFEVHKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPPKAA 3950

  Fly  3861 NFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEW-KGKSAIQRLC 3924
            .  |:..:.|..:..|:....|..:...|....|:|:.:.|.|:||.|..|..: :.....:||.
Zfish  3951 K--WILDITWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDREAPEEEPIPNAYDQALDCFRRLL 4013

  Fly  3925 IMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLG 3989
            ::|...|||.....|.:|.:.:|.:|.:...::..:|:|||.|.|.:...||.|.||...:..||
Zfish  4014 LIRSWCPDRTIAQARKYITQSMGERYAEGVILDLEKTWEESEPRTPLICFLSMGSDPTDSIIALG 4078

  Fly  3990 KSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKME--SSLS 4052
            |.......:     ||:|||||:.|...::.:...|.|.:|||.||   .|..:::.|:  :...
Zfish  4079 KRQRIETRY-----VSMGQGQEVHARKLLQHSMANGGWALLQNCHL---GLDFMDELMDTITETD 4135

  Fly  4053 NVHTSYRLFLSAEPAGDPAAH-ILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKE 4116
            :||.::||:::.|      .| ..|..:|:.:||.|||||.|:.|.:.:.....|.:.|:: |..
Zfish  4136 SVHDTFRLWMTTE------VHKHFPITLLQMSIKFTNEPPQGLKAGLKRTYGGISQDLLDV-SNM 4193

  Fly  4117 TEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL---EANTRVPWEDLR 4178
            .:::.:|:.:.:.|:.|.||||:||.|||..|.||..|...::..:.|:|   :....|.|..:|
Zfish  4194 VQWRPMLYGVAFLHSTVQERRKYGPLGWNIPYEFNQADFNATIQFVQNHLDDIDIKKGVSWNTVR 4258

  Fly  4179 YLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPS 4243
            |:.|||.|||.:|||:|:||..|:.:.:....:...:..:.:|:..|.......|..|| ..||:
Zfish  4259 YMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFSPDFHFYKGYSIPKCSNVDQYLQYI-QGLPT 4322

  Fly  4244 -ESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTP- 4306
             ::|.::|||.||:|.:.:.:::.:...:..:||: ...:.||||  :|.|:..:.:|:|:|.| 
Zfish  4323 YDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPK-DSSTGGGET--REAIVGRLADDMLEKLPP 4384

  Fly  4307 --TPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVC 4369
              .||.:.|.:..:....|..|...||.:||..::..::.:||:|.|.:.|.:.:|..:.|.:.|
Zfish  4385 DFVPFEVRERLMSMGPLQPMNIFLRQEIDRMQRVIVLVRNTLNDLKLAIDGTIIMSENLRDALDC 4449

  Fly  4370 LYMDQVPEQWTKLAYPS-MLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIM 4433
            :|..::|.:|.|.::.| .||.  ||::|:.|.|:...|:.:.| |:..|:.||||||..|||:.
Zfish  4450 MYDARIPARWKKASWASTTLGF--WFTELLERNRQFHSWIFEGR-PNCFWMTGFFNPQGFLTAMR 4511

  Fly  4434 QQTARKNE-WPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELF 4497
            |:..|.|: |.||||.|..:||:..|:::|..|.||.|:.||::|||.||.:...:.|:..|.||
Zfish  4512 QEITRANKGWALDRMVLCNEVTRWMKDDITQPPAEGVYVYGLYLEGAGWDRRNCKLIDSKPKVLF 4576

  Fly  4498 PAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGP-TFVWTFNLKSRERASKWTLAGVCLL 4556
            ..|||:.:.|.....:|.: :|..|:||..:|.. .::...:|::......|.|.||.||
Zfish  4577 EMMPVIRMYAENNGVKDAR-LYSSPIYKKPVRTDLNYIAAVDLRTSHPPEYWILRGVALL 4635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 110/606 (18%)
DHC_N2 1368..1770 CDD:285579 116/429 (27%)
P-loop_NTPase 1903..2132 CDD:304359 138/230 (60%)
P-loop_NTPase 2217..2352 CDD:304359 54/136 (40%)
P-loop_NTPase 2510..2783 CDD:304359 75/279 (27%)
P-loop_NTPase 2860..3127 CDD:304359 112/278 (40%)
MT 3140..3480 CDD:289543 103/357 (29%)
AAA_9 3509..3722 CDD:289547 94/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 217/699 (31%)
dnah5XP_021322524.1 DHC_N1 254..806 CDD:312031 111/634 (18%)
DHC_N2 1423..1821 CDD:312039 115/413 (28%)
MT <1657..4288 CDD:330758 921/2707 (34%)
Dynein_heavy 3950..4635 CDD:308587 221/710 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.