DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and LOC100497531

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017952780.1 Gene:LOC100497531 ID: Length:5017 Species:Xenopus tropicalis

Alignment Length:5068 Identity:2212/5069 (44%)
Similarity:3104/5069 (61%) Gaps:594/5069 (12%)


  Fly    12 DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPS-YSFP 75
            |.|.::....:.:::|||.|||.:.::..|.:.::::||.....:|::|....||.|:.| ...|
 Frog    20 DERVDYIREQVFRSLRLKTDKWNRFVSNEENQKLVLDFLEAAQCRRLVFFSGPGGSLHASAEQLP 84

  Fly    76 VRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNV 140
            :..:.|....:: ..|:.::..|...|:.:|::....|..:.:|..||...:|:|..|...|..|
 Frog    85 ISSKAKQFCLVK-KEPVRISTTNYKQSIEMGEVSYMILEQVPVLISEVLLTILSNPKNYTEWPRV 148

  Fly   141 IANDMKTESQEMRNGIAQMKGLVINRTIFPLPIC--MDEVMQAAPAIAMGDISVVNP---LMKHS 200
            |..|::...:.::..:..::|||..:|..|:|..  .|:           |.::::.   :..|:
 Frog   149 ILQDIRGHIENLKCKVINLQGLVSGKTYLPMPTIPEFDD-----------DTNILSTNDRITLHA 202

  Fly   201 LEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFV 265
            :|.:|::|...:.|::|..:.:||...|: |.|.|...||..:.|||..::.||....::.:..:
 Frog   203 IETIVIQWTHQITDVLNRDSAQKILKGEH-PGPSAELEFWLMQKENLYGVSCQLKSPEVQKVIEI 266

  Fly   266 LEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGLV 330
            |.:.:|.:..|:..::..|.|:|:||.||...|.|||..:...|.::|.:..|.|.||..||.|:
 Frog   267 LHRRKSSYYPSFMEMISKVDEALSEALDIELHLRPLKFYIAHLEESNMPDIESFILPLFHTISLI 331

  Fly   331 WGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYKLIYNE 395
            |.||:|:.....:.:....|.|.:||.....:.|:.||:.:::|..:|:...:|..:.:|::::.
 Frog   332 WTHSKYYCFPQRIIVLLQEFCNLVIDRAQNYLIPEEIFKMELEEGLEKVQQTIQMFKSFKMVFSL 396

  Fly   396 CR----NSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELK-------------------- 436
            .:    .|.||..:.|      |.:..:.:|.|.|..|.||..::                    
 Frog   397 YKEGVSGSAKKDGVKT------WDFPSNLVFFRFDSILERLTYIEVYQNAVSKTQVDIAHLLHIH 455

  Fly   437 ----------------------------------------------------------------- 436
                                                                             
 Frog   456 IQPFTPIEYSFMKIEASLTVLMMLSTSIKPATSARNDGAPGHFSLVLTNSLRKFTLLPFLVVNEL 520

  Fly   437 DLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRL 501
            :||....||.|||::.:|||:|:.::..:..:.||.|..:|.....:|:|:  |..|:.|..|.:
 Frog   521 ELFTAAIDFLKLERVEIGGLRGKILSEEVHAMCEESNESWRILQESKYDPL--DYTNTDFLVDYV 583

  Fly   502 SFKAKTDVME----RMVSFQFEKG----LEDTHDLLLAGSLLLRPII-----KKHVE-------- 545
            .:..:.:..:    |:::..||:.    |::.|...|:...|...|:     |.:.|        
 Frog   584 RYSQQINDFDHHLGRILNLAFEESNGLDLKNAHFWRLSPLWLKNEIVASQNQKAYTEFWELNNNS 648

  Fly   546 --PL-------------MHVIVDDFEEEIMCVKKEFIN-----FKNVFTALGLNELPTDDCFPKV 590
              ||             :..::.....|    |||.:|     |....||...|  ||:..:.::
 Frog   649 ASPLTLWDASKAVMRGELTAVISQARNE----KKEQLNEAEKSFVAAETAHAQN--PTEHTYEQL 707

  Fly   591 SGAISFLKKLRHRIIGLHKEHELYEYPLFDNER-------------------------------- 623
               :|....|....:.|.::..||:     |:|                                
 Frog   708 ---LSARNSLSRATVSLTRKAVLYQ-----NQRVFEQGDKNSKILAYLSKPQNNSTAIPHIRQDD 764

  Fly   624 --------------GGYVSDIF----------------NIMVQEIDDFTKMLLD----------- 647
                          ..|..:::                :|.:.:|....|..||           
 Frog   765 GMLTTEPKNIAQQFASYYKNLYTTTTTYSTTQLAQYLASIPIPQIAPPDKAYLDAPITKQEVAEA 829

  Fly   648 -----------------KWTVECWQGIQQDITLTLIEKDEANELRVNFTERLIFAL----KD--- 688
                             .|..|..:.|...:..||....:...|..:|.|.||..:    ||   
 Frog   830 IATLPSNKTPGPDGLPSNWYKELAEYIPSKLLETLQYAYDNQALPASFAEALIVVIPKPGKDPSL 894

  Fly   689 ---IKVVRLLGCDVSVNLTKFFCR-------------EDELWQAR---VKLMRI----------- 723
               .:.:.|:..|..: |.|....             :......|   :||.|:           
 Frog   895 CSSYRPISLINTDAKI-LAKILATRLQRVVPDLVHPDQSGFMPGRSTDIKLRRLFTNLQIPHLET 958

  Fly   724 ----------------AEW-----------YNDTFER------AHPTEK-RL------------- 741
                            .||           :..||.:      .|||.: |:             
 Frog   959 DTRVIASLDSAKAFDSIEWGYLWEVLSGFGFGQTFLKWIKLLYQHPTARVRVNGITSPPFSLERG 1023

  Fly   742 -------------IAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEA 793
                         :|.|.:.|..:..|.:..:.:....::..:....::.||.|    .:::|.:
 Frog  1024 TRQGCLLSPILFALAIEPLAILIRNSPEIRGLTYGNIHEKLSLYADDLLTYLAD----PRDSLTS 1084

  Fly   794 IKESIRSWGKVPLFQRKDLNPALLLHTDP--REPILSIRAA-------------NAADTQRLIDL 843
            :.:.:..:|..... |.:.:.::|...||  .:|:|.|..|             |.|....:.:|
 Frog  1085 LLQQVDKFGHYSGL-RINWDKSILCPIDPLQPQPVLQIFGALLDRPVINSLFRPNYAKLLSMFEL 1148

  Fly   844 ---------------------LMYVN-------LKLFFDIPRRYSLPPGEH-------------- 866
                                 :::.|       |||..::..|..    :|              
 Frog  1149 EINSCRRIFHSQEEKWNDGQGVLHKNMPVTSGTLKLSQELRERME----KHRSCFKHTSLRALQN 1209

  Fly   867 -----------------GEEDEESDGIW-------------PPII------------------SL 883
                             .|.|:|:..:|             .||:                  ||
 Frog  1210 EEANRIFEKYDKFMKLLDEHDKETFSVWAQDLSDCCETYLNQPILRCDNNGVYDTNFNPKHIGSL 1274

  Fly   884 SVMTSVKFKKKREVIDEE-----DDLEEFEEEQS-----------------ESEEEII------- 919
            :::|....:.:|.::..|     |:|:..|::..                 |..:|::       
 Frog  1275 NLITEWFNRLQRTILQVERDLMQDELQAMEDKMKPALSLLTWQTEDLDTYIEETKELVCGVGSRV 1339

  Fly   920 ------------------------------TPFHR---------------------YELLKGLSQ 933
                                          .|..|                     .|||:...|
 Frog  1340 LKAKQNVEMMQCLLDKLHVNLFVVRKYGKTIPLLRLRDKERTDKQYAVASDVGSKIQELLQNNQQ 1404

  Fly   934 EERA-----LFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYEN--NTPIFEIFMELQEPNV 991
            ..:|     :::.|..|:|.||.|.|..:|..|..||   :||...:  .:|:||:.:.|....:
 Frog  1405 LFQADPISDIWKVYTEYLDHIIQEGLCKAVKHSLQYL---IDNTEASLKKSPLFEVELVLSGGEM 1466

  Fly   992 VYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRV 1056
            .:..:|::.....|:..||::|.|...:.|.:.|||      .::...::..::.:..:|.:...
 Frog  1467 TFRPSLESKISDNFSNIIESLLRDTYQIASFIPRVA------AHLGKETYQQDVDETEKLREMHG 1525

  Fly  1057 EIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLL 1121
            |||.::...:..|:|:.:.|.::|.||..||:.::.:...:||.|:.:|.:..||.|       |
 Frog  1526 EIMRRVHSTIVNVKVYQRHFEKYSYLWTDDKAEFMKQFLLYGRFLSTEEMELYADYE-------L 1583

  Fly  1122 GLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLIN 1186
            ....|.|..:::|::.:..|..::..:|:.:.|..:|.::...||:::::::.:|..:||..|:|
 Frog  1584 QKCTPQLEHFEKQINVYESLYKEVGGFESEKIFDGWLLVDTKPFKLSLMNEIKKWSWMFKEHLLN 1648

  Fly  1187 RVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQ 1251
            .|.:|..:|.:|:......|..::|.||:..||:|:|.|..|.::... |..|..||...:|||.
 Frog  1649 HVTSSANKLVEFIQLTEKGLAKKVQGDDYTALVEIMSHLMAIRDRPST-DEQFRHLKATAELLRD 1712

  Fly  1252 YNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLS 1316
            |.........:|:.|||:.|..:|:.|...|..::|:||.:|.:|.::.:|.:...:.:|.:|.:
 Frog  1713 YGQHLPGQIYSQLEELPERWKTLKKTAFIVKHEVSPLQSNEVSVIRRKCVLFEVKQHEFRSRFKN 1777

  Fly  1317 KKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDF 1381
            :..|.......|:.:|::...:..||...:.|.|:|.|||:..|:..:::.||..:.|:|.:||.
 Frog  1778 EIIFNFDADRPYKHLDKTHRNIARLEGEMKKLQETADLFEVNMPEYKQLQQCRVAIILLKSVWDM 1842

  Fly  1382 AITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAV 1446
            .|.::::|.||.|||||:|::|.||.|.::|.:|::.|||.:|||..::.:|:::|||:||||||
 Frog  1843 VIFVRTSIKDWMKTPWKQINVEQMDMELRRFAKEMKTLDKEVRTWHVYLGLESTVKNLLTSLRAV 1907

  Fly  1447 TELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLR 1511
            .||||||:|.|||::||..|.|:|.|::.|.|.||:.|.||:.|:||||||||:|||||:||.|.
 Frog  1908 NELQNPAVRKRHWLQLMSKTGVRFVMNEETVLGDLLALQLHKVEDEVKNIVDKAVKEMAIEKVLS 1972

  Fly  1512 DIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLS 1576
            :|...|..|||..:.|. |...|||:.|.|||||||:|.||||:..|||:.:|..||..||.:|.
 Frog  1973 EINHTWSIMEFSYEKHP-TGTPLLKSDENLIETLEDNQVQLQNILMSKYVEYFSVEVSRWQKKLI 2036

  Fly  1577 NADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRN-VVRST 1640
            .||.:|..|.:||:.|.:|:|||..|||||:|||||::||:.||.:||.::..:....| |:..|
 Frog  2037 VADMVISVWLQVQKTWAHLQSIFSNSEDIRNQLPEDAKRFEGIDMDFKEMMEGIVTSSNIVIEVT 2101

  Fly  1641 NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLT 1705
            :::|  |.|.||.|.:.|.||||:|.||||.|||.:||||||||.|||:|:|.|..|..|.||..
 Frog  2102 DQTG--LLERLEALQQRLTLCEKSLADYLEAKRLRFPRFYFVSSVDLLEIISKGTQPKQVTRHFL 2164

  Fly  1706 KLYDSMGKLNL---ISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLK 1767
            ||:|::..|..   ...::.|.||.::| .|:|||::.|.|.|:.|.||.|:.:.||.|:|.::.
 Frog  2165 KLFDNIADLRFEDEEGKAQTAVGMFSRE-GEFVPFIKLCVCEGQAEGWLRRLEETMRATVRQEII 2228

  Fly  1768 RSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLI 1832
            .:::.|:.|||..|:|::.||.||.|:||.:..:...||.::::.:|.||||||:|||.|||.||
 Frog  2229 EAVSGYEDKPRDQWMFDYSAQVALAGSQIWFVADVEIAFERLEEGFETALKDYNRKQIAQLNALI 2293

  Fly  1833 ILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANIC 1897
            .:|||:.|..:|||||||||||||:||||..:||:||....||.|.|||||||:.:..:||.|||
 Frog  2294 NMLLGEHTPGDRQKIMTICTIDVHARDVVAKLIAQKVSNGQAFTWLSQLRHRWEEEQKECFVNIC 2358

  Fly  1898 DAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMV 1962
            ||||:|.|||||||||||||||||||||||||||||.|.||.:||||||||||||||||:||:||
 Frog  2359 DAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLAMSGALSGPAGTGKTETTKDLGRSLGIMV 2423

  Fly  1963 YVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFL 2027
            |||||||||||||||:|:||:.|||.|||||||||||||||||||||||.|||||:.||:.|.||
 Frog  2424 YVFNCSEQMDYKSIGNIYKGICQTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAIRHKKKRFYFL 2488

  Fly  2028 GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLAR 2092
            ||.|.|.||:|:|||:|||||||||||||:|||:||||||:|||.||.|||||||||.:||:|:|
 Frog  2489 GETIELITTIGIFITLNPGYAGRAELPENVKALFRPCAMVIPDFELICEIMLVAEGFVDARMLSR 2553

  Fly  2093 KFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDD 2157
            |||:|||||::|||||||||||||||||||||||:|:|:||.:|||.||||||||||:|||||:|
 Frog  2554 KFISLYTLCRQLLSKQDHYDWGLRAIKSVLVVAGSLKREDRSKPEDLVLMRALRDFNLPKIVTND 2618

  Fly  2158 VPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIG 2222
            |.:|:|||.||||.|:|||||:.:.|.::::|..:|.||||:.|||||.|||||.|||||||::|
 Frog  2619 VAIFLGLINDLFPMLEVPRKRDVKLEQMVRQSVAELHLQPEENFILKITQLEELLAVRHSVFVVG 2683

  Fly  2223 FAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANL 2287
            .||||||.:.:||::||.|.|.||.:||:||||||.|||||.::||||||||||||.:||:...:
 Frog  2684 NAGTGKSTILRTLHRTYSNMKLKPTWNDINPKAVTTDELFGFLHPSTREWKDGLFSFIMRELFII 2748

  Fly  2288 GGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSR 2352
            ...|||||||||||||||||||||||||||||||||||||:|:..|||||||:.||.||||||||
 Frog  2749 PHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLSPSMRLLFEISHLRAATPATVSR 2813

  Fly  2353 AGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQ 2417
            |||||:|.|||||:|::.||:.|....||.:.|.:|||||||..|:..|..|::||||.:.:.:|
 Frog  2814 AGILYVNTQDLGWSPYVTSWIETHKTQSEKANLTILFDKYVPYCLEQVRCNLKTITPIPENSMVQ 2878

  Fly  2418 MTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEYKAVKF 2482
            ..|.|||.:|||.|.|.|.|::.|||||||..||.||.:|||||:||:..|||||:..|.:.:||
 Frog  2879 TLCSLLDCLLTPDNTPPDSPRELYEIYFVFACVWSFGGALFQDQLIDYRLEFSKWWNKEMRTIKF 2943

  Fly  2483 PLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLML 2547
            |..||:|.:|||.:||:|.||...:|:|::..|.|||:.||:||||.|:|:|:|.|:|...|:||
 Frog  2944 PSHGTVFDYYIDPDTKRFTPWAEKIPEFDMVPDSPLQTVLVHTAETVRVRYFLDLLLEKGKPIML 3008

  Fly  2548 IGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMI 2612
            :|.:|.|||:|:..|::.| |:.|.|..||||:||:|.||||:|||.|||||||||.|.|.|::|
 Frog  3009 VGNAGVGKTVLVTDKVTKL-SEDYMVAKVPFNYYTSSAMLQRVLEKSLEKKAGRNYAPSGTKKLI 3072

  Fly  2613 YFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFTIDPRL 2677
            ||:||:||||||.|.||||||||||.:||.|||||||:..::||.|..:.||||:||||:|:|||
 Frog  3073 YFIDDLNMPEVDAYCTVQPHTLIRQHLDYSHWYDRQKLIAKEIHNCQYITCMNPAAGSFSINPRL 3137

  Fly  2678 QRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPT 2742
            ||||..|||:.|..|||..|.:.|:|.|..:  ..|..:|||....:|..||.||.|:..:||||
 Frog  3138 QRHFSVFAVHFPGADALNTIYSKIISTHFQH--GSFSYSVIKAVPTLVQAAICLHQKMTQNFLPT 3200

  Fly  2743 AIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSD 2807
            ||:|||.|||||:.::|.|:|.::.|....|:.:::||:||..|||.|||::..||..|||::.|
 Frog  3201 AIRFHYIFNLRDLTHVFQGILLASPECIRFSSDLVQLWLHESSRVYSDKLMEEKDIEQFKKVLID 3265

  Fly  2808 IVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLF 2872
            ..::..||:::|.:...||:|.|||.|:.:.:|.|:|.|::|..:|.:..:.||:...|||||||
 Frog  3266 TSKRYFEGIDEDALLQMPLVYSHFAHGIGEPRYFPVSDWEKLTRILTDILEHYNEIHAAMNLVLF 3330

  Fly  2873 DDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIA 2937
            ::|:.|:||||||||...|.||||||||||||||.|||:|:|||:||||.|.|.|.::||:::||
 Frog  3331 EEAIQHICRISRILEFPYGNALLIGVGGSGKQSLCRLAAFLSSLEVFQITLRKGYGINDLRSDIA 3395

  Fly  2938 TLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGI 3002
            |||.|.|||.....||.||:::..|:||||:||:||||:|.:||.::||::||::.|.|::.||:
 Frog  3396 TLYFKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGEIPDLFSEEEVDSIVSSTRMELRALGL 3460

  Fly  3003 VDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLR 3067
            .|:|||||::||:::|..||:||||||||.|||.|:||||||||||.|||||.||..||:|||..
 Frog  3461 PDSRENCWQFFIDRIRRQLKIVLCFSPVGFTLRARARKFPALVNCTAIDWFHAWPDAALQSVSSS 3525

  Fly  3068 FLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVK 3132
            |:..:..|..::...:|.|:.:.|.:||::|..|..|.|.|||||||||||||.||..||.:|..
 Frog  3526 FIQRLEGLDPQVKESISQFITYAHTSVNEVSVKYQQNEKHYNYTTPKSFLELIKLYWNLLGKKRN 3590

  Fly  3133 ANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFA 3197
            ..:.:..||||||.||.:...:|:.|:..|.||||||:.||::.:.||..||.:.||:::|:..|
 Frog  3591 ELVQKMERLENGLQKLQTTALQVEDLKSKLAVQEVELQQKNRDMEALISKVGQQTEKLNQEKTVA 3655

  Fly  3198 SKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCG 3262
            ..||:.:..|:.::|.:.:...:|..||:|||.||..||||||:.|||||::|.:||.||.:|..
 Frog  3656 DAEERKIAAIQAEITKQQQESADDLAKAEPALQAANAALNTLNRLNLTELRAFPNPPVAVTNVTA 3720

  Fly  3263 AVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQ-PYILDAEFSPEK 3326
            |||||.|..||||:||||||.:..|..||:||.|||.::|:|||..|:|||: .|:.|.||:||.
 Frog  3721 AVLVLLSPNGKIPRDRSWKASKVLMSKVDEFLQNLITFEKEHIHDAVVKALKDEYLSDPEFNPEF 3785

  Fly  3327 ILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNA 3391
            :..|||||||||:|||||.||::|:..|:.|.:.|.::..::..|.:||..:..:|.||:..|.|
 Frog  3786 VRMKSSAAAGLCAWVINIIRFHEVFCEVDIKRQLLSQANTDLVIAAEKLEMIQKKLEELDTNLAA 3850

  Fly  3392 LQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIIS 3456
            |..:::.|.|:|.:||:|.::|..||::||||:.||.:|.:||.:||.:.......|.||:|:.:
 Frog  3851 LTTDFERATAEKIRCQEEVNRTNKTIELANRLVKGLESENVRWAQSVAIYHEQEHTLCGDVLLTA 3915

  Fly  3457 CFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMS 3521
            .||||.|.|::.||.||.|.||||..::.:.|||.|:|:||..|:.|||.||:|||:|||||.||
 Frog  3916 SFISYAGSFSKKYRYELVEHLWMPFLRSQKYPIPMTEGLDPISMLTDDATIAKWNNEGLPSDTMS 3980

  Fly  3522 AENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIG 3586
            .:|..||...||:|||||||||||||:|::||:.|..:.|.|:.|:|::|:||..|..:||||:.
 Frog  3981 IQNGTILTNCERWPLMIDPQLQGIKWLKSRYGSRLKAIHLGQKGYVDEIEQAVVAGDPVLIENLE 4045

  Fly  3587 ENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTR 3651
            |.|||||:.||||..:|||..::|||:|..|:.:|||||||||||||||||:|||||||||||||
 Frog  4046 ETIDPVLDALLGRHTLKKGKYIRIGDKECKFHPKFRLILHTKLANPHYKPEIQAQTTLINFTVTR 4110

  Fly  3652 DGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNL 3716
            |||||||||:||.:||||||..::.||:|||:|||.||.|||:||.|||:|..|.|.|..||..|
 Frog  4111 DGLEDQLLADVVNLERPDLEQFKSELTKQQNYFKIELKMLEDELLTRLSAAESNFLGDTLLVEKL 4175

  Fly  3717 EKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVV 3781
            |.||.||.|||:||.|||:..|:|:.|||.|||.|.|||::|||:|||.||:|:||||||||.:|
 Frog  4176 ETTKLTAAEIEMKVLEAKVNEVKINEAREHYRPVAARASLLYFIINDLKKISPMYQFSLKAFNIV 4240

  Fly  3782 FNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTEL 3846
            |:.::.:|.:::.::.||.||||.:|:.:|:|.||||||:||:.|.:||..|:|:...|:...||
 Frog  4241 FHKSVRQAESSDDVQTRVNNLIDCVTYSTFIYISRGLFERDKVTFTSQLAFQLLLMNKEISAQEL 4305

  Fly  3847 DFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFP 3911
            ||||||....|..|...:|::..|..|:.::....|:||::|||||.|||||.|:||.||.|:.|
 Frog  4306 DFLLRFNVEHNYNSPLEFLSNSAWSAIKTMSFMDEFRGLDRDIEGSPKRWKKVVESECPERERLP 4370

  Fly  3912 GEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLS 3976
            .|||.||::|::.:||.:|||||:||:|:|:.||||:||::.|..|||::|:||.|.|.|||:||
 Frog  4371 QEWKTKSSLQKMIMMRALRPDRMTYAVRNFVGEKLGTKYVETRKTEFSKSFQESGPGTAIFFILS 4435

  Fly  3977 PGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLP 4041
            ||||||||||.||..|||:.|....|::|||||||::||.|:|.||:.|||||||||||||:||.
 Frog  4436 PGVDPLKDVESLGDRLGFTIDSGKLHNISLGQGQEVIAEIAMEKASKEGHWVILQNIHLVAKWLS 4500

  Fly  4042 SLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFS 4106
            :|||.:|......|..||:|:|||||.....||:||||||:||||||||||||:||:|.|||||.
 Frog  4501 TLEKLLERYSEESHPDYRVFMSAEPAPTHKEHIIPQGILENAIKITNEPPTGMLANLHSALDNFD 4565

  Fly  4107 DETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTR 4171
            ...|:.|::|.|||:||||||||||.||||||||||||||.||||:|||||||.:||||||||.:
 Frog  4566 QNILDQCTREQEFKSILFSLCYFHACVAERRKFGPQGWNRKYPFNIGDLTISVSILYNYLEANAQ 4630

  Fly  4172 VPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNY 4236
            ||||||||||||||||||||||||||||.|||||||||...|.:|....||..|..|.|.|||.|
 Frog  4631 VPWEDLRYLFGEIMYGGHITDDWDRRLCCTYLEEFMQPNQFDRKLALAPGFVVPSNLDYQGYHTY 4695

  Fly  4237 IDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQ--EDIIKNIIE 4299
            ||:.||.|||..||||.||||.|||..|:.|||.:.|||.|   .|..||..:|  |:.:|.:::
 Frog  4696 IDEMLPPESPIHYGLHPNAEIEFLTVTSDNLFRTLLELQSR---DSIIGEGAAQTEEEKVKTVLD 4757

  Fly  4300 DILDKTPTPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVME 4364
            |||:|.|..:|:.::..:..||||||:|.||||||||.|:.|::|||.||||||||||.|||.||
 Frog  4758 DILEKLPEGYNMSDITSKTADRSPYILVCFQECERMNTLIHEIRRSLKELDLGLKGELAISSEME 4822

  Fly  4365 DLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLL 4429
            .|...|:.|.||:.||||||||...|..|::||:||.|||:.|..|..:||.:|::|||||||.|
 Frog  4823 QLQSALFFDNVPDTWTKLAYPSTYSLAQWYNDLLLRCRELDTWTQDLSLPSVVWISGFFNPQSFL 4887

  Fly  4430 TAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLK 4494
            ||:||..|||||||||:|.|..||.||:|||.:...||||||.||::||||||::.|.||:|.||
 Frog  4888 TAVMQSLARKNEWPLDKMHLTVDVMKKYKEEFSQPAREGAYIYGLYLEGARWDVQNGHIAEARLK 4952

  Fly  4495 ELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLL 4557
            ...|.|||::::|:..|:|:.:|:|||||||.:|||.|:||.|:||::|:.|||.||||.|||
 Frog  4953 APTPIMPVIFVRAIPNDRQETRNIYECPVYKTKLRGSTYVWAFHLKTKEKPSKWILAGVSLLL 5015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 157/883 (18%)
DHC_N2 1368..1770 CDD:285579 200/406 (49%)
P-loop_NTPase 1903..2132 CDD:304359 190/229 (83%)
P-loop_NTPase 2217..2352 CDD:304359 99/135 (73%)
P-loop_NTPase 2510..2783 CDD:304359 150/273 (55%)
P-loop_NTPase 2860..3127 CDD:304359 157/267 (59%)
MT 3140..3480 CDD:289543 161/341 (47%)
AAA_9 3509..3722 CDD:289547 137/213 (64%)
Dynein_heavy 3864..4549 CDD:281078 421/687 (61%)
LOC100497531XP_017952780.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.