DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah7

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_002937766.2 Gene:dnah7 XenbaseID:XB-GENE-6034836 Length:3992 Species:Xenopus tropicalis

Alignment Length:4089 Identity:1293/4090 (32%)
Similarity:2046/4090 (50%) Gaps:465/4090 (11%)


  Fly   728 NDTFERAHPTEKRLIAAEMILIEEQMKPLL--DFIKWNAFSQRFI----------VMIFKMVKYL 780
            |||.....|         ..|.|..:.|.|  |.:::|.:....|          ..:..::|.:
 Frog   108 NDTAAAEQP---------FCLDETHISPALEKDILRYNYYIHHGIDTEHVAPMEDSWLENVLKLV 163

  Fly   781 HDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLM 845
            .:.|...:|::|.:.:.||                       .:.:||::.|       ::|.::
 Frog   164 PEHLNTYRESIEMLSDEIR-----------------------EDYLLSVKKA-------IVDFVL 198

  Fly   846 YVNLKLFFDIPRR---YSLPPGEHGEE-------------------DEESDGIWPPIISLSVMTS 888
                    ..||:   |......|..|                   .|..:.|.|.:.::..:..
 Frog   199 --------KDPRKKEEYKTSNIPHRAEIEIVPKPWKKSFLVNCNTIKENLNAINPTMAAVLDLWH 255

  Fly   889 VKFKKKREVIDEEDDLEEFEEEQSESE----EEIITPFHRYELLKGLSQEERALFREYEIYVDEI 949
            ..|.:.|.|     |.:||...|...|    :.::|        :.:...:..|.:::...:..|
 Frog   256 SSFGQLRLV-----DTDEFHSRQESMELSIFQNLVT--------RHIDSAKDKLLKKWFPEIQNI 307

  Fly   950 IAE-NLVDSVITSSTYLRME--------VDNRYENNTPIFEI-------------FMELQEPNVV 992
            ..: |....:.:||.|.::|        :.|....:..:..|             .:..:.|..:
 Frog   308 FYQGNKRKQIPSSSNYKKLESFFNCAATLMNGQLQSLALVSIQDYTDLIVQPPDSVLAYEHPGFI 372

  Fly   993 YFRNLDTSS---KTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQ 1054
            ....||.:|   |..|..: ||.|.::.:||  :|.|...|...|.:  ||.:.....||.| |.
 Frog   373 IRLILDNTSIKFKPDFNEY-ETALLNVYDMM--IKAVNVVPRVETKL--YSEWQGQSSKSTL-KP 431

  Fly  1055 RV--EIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSG 1117
            .:  ||:.|.|.|::.. |..:.|:....|.::||..:|.            .:.|:.|::    
 Frog   432 IIPEEILEKHKWAVKEF-VAKESFLPMEHLKLYDKYNFLI------------SKQADLDVD---- 479

  Fly  1118 VKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNM-------------------T 1163
             :.|..|:....:.:|.| |:..|..:|:....     .|:||.|                   :
 Frog   480 -QFLAEEHTFEEIMREVL-KYKALTSEIQYTSR-----KFIRLGMFELHCDELIRALTKRSEAIS 537

  Fly  1164 GFKVAVLSQVGQWISLFKLDLINRV-------KNSLKELQDFVDEANIVLKIELQKDDFEGLV-- 1219
            |..||.:..|.|.::....|...|:       .:|..||.|        ||..:.|.:.:.:|  
 Frog   538 GKLVAKMFSVHQEVNKILCDEFERIAEKALSTPSSTHELMD--------LKAYIAKVEAQHMVEM 594

  Fly  1220 --KILSVLNQI-----------------NEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQIN 1265
              |::...|::                 |.....:..|.|..:|...::::...:|::....:..
 Frog   595 EQKLVDAKNRLVFLVDYAIFSPSDIRLNNSTFHWHSRMGDIFEEHKRIVKEKTEQFQEELKLRCE 659

  Fly  1266 ELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKK--FLSKKFFFVPCLSCY 1328
            :.      |:.|....|| :...|||. |:.|         ...|.||  .|:.|.        .
 Frog   660 KF------VEELENCAKQ-VEEFQSYG-DMQE---------VTKYLKKAQTLNSKL--------D 699

  Fly  1329 ELIDESDLELVALEER---------QRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAIT 1384
            :.:|:.| :|.|.||.         ||...:.|:       :|.        |:|.:|..:|...
 Frog   700 QAVDKID-QLNAEEEAFGWGASQYPQRKKIQDAL-------NPY--------LRLYEITSEFNAK 748

  Fly  1385 IQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTEL 1449
            .:|    |.:.|:..::.:.::|:...:.|.|..|:|........:.:.|.:|..:...:....|
 Frog   749 YKS----WMEGPYTSVNPDLVEQDVGNYWRSLYKLEKTFNESPSALSLTAKIKTKVEEFKEYLPL 809

  Fly  1450 ----QNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQL 1510
                .||.:|||||..:...........:.|.:...|::||..:.|:.:.|.:.:.||.::||.:
 Frog   810 IQIVCNPGLRDRHWDSMSAIVGYSIKPQEDTNMMKFIEINLQPFLEKFEGISEAASKEFSLEKAM 874

  Fly  1511 RDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRL 1575
            ..:...|..:|||...:..|...:|.:.:::...|:||..:.|.|..|.:|..||:|:|.|:::|
 Frog   875 EKMICEWDKIEFGLHPYRETGTYILSSVDDIQMLLDDHLVKTQTMRGSPFIKAFENEIREWESKL 939

  Fly  1576 SNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNV---- 1636
            ....:|:..|.:||..|.|||.|| .|.||.:|:||:.|||..:||.::.|:.|:..|::|    
 Frog   940 LLLQEILDEWLKVQATWLYLEPIF-SSPDIMAQMPEEGRRFSTVDKTWRDLMKQVLLDKHVLTVV 1003

  Fly  1637 -VRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALV 1700
             :........|..|.||::|       |.||:|||.|||.:|||:|:|:.:||:|||...:|..|
 Frog  1004 TIEKMLEKFKKSNEFLELIL-------KGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRV 1061

  Fly  1701 ARHLTKLYDSMGKLNL-----ISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRD 1760
            ..||.|.::.:..:..     |:..|::.|    |:.:.|..:......|:||.||..:...|..
 Frog  1062 QPHLKKCFEGIANVEFTDVLDITHIKSSEG----EVVQLVNTISTSKARGQVEKWLVEVETAMIQ 1122

  Fly  1761 TLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQI 1825
            ::...:..::..|...||..|:.|||.|..|..:|..||.|...:..|.||    ||::|.:|..
 Frog  1123 SVHKVIGEAIEAYPKTPRIDWVKEWPGQTVLCVSQCFWTQEVQTSIQKGQQ----ALEEYLEKNN 1183

  Fly  1826 TQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKID 1890
            .|:::::.|:.|.|:...|..:..:..:|||:|||:.:::.|:|..:..|:|.||||:.|:.  .
 Frog  1184 KQIDDIVALVRGTLSKQNRVTLGALVVLDVHARDVLASLVKKQVNDENDFEWLSQLRYYWEE--G 1246

  Fly  1891 DCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLG 1955
            .....:.:|..:|.||||||||||||||||||||.||..:|:|.:||||.||||||||||||||.
 Frog  1247 HLQTKMINAGLQYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLA 1311

  Fly  1956 RALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSK 2020
            :|:.....|||||:.:||.::|...|||...|||.||||||||.:|||||||.|:..||..|.:.
 Frog  1312 KAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTG 1376

  Fly  2021 KQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQ 2085
            .....|.|..:.|..|..||||||||||||:|||:|||||:|..||:|||:|:|:||:|.:.||.
 Frog  1377 SNLLVFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFV 1441

  Fly  2086 EARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNI 2150
            .||.|:.|.:..|.||.|.||.|.|||:|:||:||||..||.|:.......|:.:|:|::.|.|:
 Frog  1442 RARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNEDEEILLLRSIIDVNL 1506

  Fly  2151 PKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVR 2215
            ||.::.|:|:|.|:..||||.:.:|:.....|...||.:..::.||....|..||:|:.|:..||
 Frog  1507 PKFLSQDLPLFEGITSDLFPGVKLPKADYQVFMDAIKENCQNMNLQMTSFFSEKILQIYEMMIVR 1571

  Fly  2216 HSVFIIGFAGTGKSEVWKTLNKTYQN-------QKRKPHYNDLNPKAVTNDELFGIVNPSTREWK 2273
            |...|:|....||:..::.|.....:       .:.|.....||||::|..:|:|..:|.:.||.
 Frog  1572 HGFMIVGEPFGGKTSAYRVLAAALNDICEKGLADENKVQITVLNPKSITMGQLYGQFDPVSHEWS 1636

  Fly  2274 DGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFE 2338
            ||:.::..|..|:......||::.||.:|.:|||::|||:||||.|.|.|.|.|.::.:|.|:||
 Frog  1637 DGILAVSYRAFASSTSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFE 1701

  Fly  2339 IASLRTATPATVSRAGILYINPQDLGWTPFIQSWLG---TRTNSSEVSMLNVLFDKYVPPLLDIF 2400
            ...|..|:||||||.|::|:.|..|||.|.:.|||.   ...:......:..|||:.|||.|.:.
 Frog  1702 PMDLEVASPATVSRCGMIYMEPHMLGWRPIMLSWLNVLPAGLSQMHKKFIEGLFDRMVPPCLQMI 1766

  Fly  2401 RTRLRSITPISDIARLQMTCYLLDSMLTP-------QNVPNDCPKDWYEIYFVFCIVWGFGSSLF 2458
            |...:.::|.||...::....|:|.|:..       ||:.......|.|..|:|.::|..|.|..
 Frog  1767 RKCAKELSPTSDTNLVRSLMNLMDCMMDEFSDESLVQNMSEREICSWLEGIFLFSLIWSVGGSCK 1831

  Fly  2459 QDQIIDWS---NEFSKWFLNEYKAVKF-----------------PLSGTIFSF-YIDHETKKFFP 2502
            :|..:.:.   .|..:..|:|....:|                 |...|::.: ::..:..::..
 Frog  1832 EDDRVKFDRLLREIIEGPLSEESRTRFKILHPVDPPEKPFTVPIPKENTVYDYKFVKQDVGRWEL 1896

  Fly  2503 WTNLVPQF-ELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGK-TILMNAKLSA 2565
            ||..:... .:..::.....:|.|.:|.|....|:.|.......:.:||:|:|| |.:::..|:.
 Frog  1897 WTEALSSAPSIPREMMFNEIIVPTLDTVRYTELMNLLTTHQKSAVFVGPTGTGKSTYIIDFLLNR 1961

  Fly  2566 LPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQ 2630
            |..:.|....:.|:..||:...|.|:...|:|:....:||...|:.:.||||:|||..:.|....
 Frog  1962 LDKETYKPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKTVVFVDDVNMPAREVYGAQP 2026

  Fly  2631 PHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDAL 2694
            |..|:||::|:.:|||.:..::..:....|:..|.|:.|... |.||..|||.:..:|....:::
 Frog  2027 PVELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPAGGGRNPITPRFLRHFNTVTINEFDDNSM 2091

  Fly  2695 FHILNSILSQHMDNPIQ-KFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANI 2758
            :.|.:.||..|:  .|: .|......|...::.:.:.::.:.:...|||..|.||.|||||.:.:
 Frog  2092 YTIFSRILDWHL--TIRYNFPNEYKALTPQIIHSTMAVYKEALKHLLPTPAKSHYLFNLRDFSRV 2154

  Fly  2759 FTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTD----INSFKKIVSDIVRKGIEGV--- 2816
            ..|:..|..||..:...:.|||:||..|||.|:|||..|    :...:::|...:|:....:   
 Frog  2155 IQGICLSRPETSDSPLLIKRLWVHEVLRVYFDRLVDNGDRSWLVGYIEEVVKSHMREDFNKLFQH 2219

  Fly  2817 ----------NDDVVYAQPLIYCHFAKGLTDIK-----YMPISGWDRLKSLLDEAQDRYNDYI-G 2865
                      .||:   :.|::|.|    .|:|     |..|:..::|:.:::...:.:|:.. .
 Frog  2220 LDFDGDGKVQEDDL---RSLMFCDF----HDLKREDTNYKEINDVEKLRLVVESHLEEFNNISKK 2277

  Fly  2866 AMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVS 2930
            .||||||..|:.|:|||||||:..|.:|||:||||||:|||||||..::...:||::::|.|..:
 Frog  2278 TMNLVLFRFAIEHICRISRILKQPRSHALLVGVGGSGRQSLTRLAVHMADYRLFQVEISKSYGNN 2342

  Fly  2931 DLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRN 2995
            :.:.::..:..|:........||.|||::.:|.||..:|:||.:|::..||..||.:.|...:|.
 Frog  2343 EWREDLKLILRKSTEGEMQGVFLFTDSQIKKESFLEDINNLLNAGEVPNLFAVDEKQEICERMRQ 2407

  Fly  2996 EVKQLGIVDNREN----CWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEW 3056
            ..:|.......:.    .:..||::.|..|.|||..||:|...|.|.|||||||||.|||||..|
 Frog  2408 IDRQRDKTKQTDGSPLALFNLFIDRCRDQLHVVLAMSPIGDAFRDRLRKFPALVNCCTIDWFQPW 2472

  Fly  3057 PQQALESVSLRFLSEITVLPKELALPVSN-----FMAFVHKTVNDISKLYLANAKRYNYTTPKSF 3116
            |:.||::|:.|||.::     |::..|.|     ..:|...|:| :|..:.:..:||||.||.|:
 Frog  2473 PEDALQAVATRFLEDV-----EISEEVRNGCIDMCKSFHTSTIN-LSDRFRSELQRYNYVTPTSY 2531

  Fly  3117 LELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLII 3181
            ||||:.:..||.:|....:..:.|.|.||.||.|.:.:|..:|..|:..:.:||:.::|.|.:::
 Frog  2532 LELISTFKTLLQKKQTEVMKMKRRYEVGLEKLESASSQVATMQSELEALQPQLKVASKEVDEMMV 2596

  Fly  3182 VVGTENEKVSKERAFASKEEKNVRQIEEDVTAKA--KLCEEDFLKAQPALIAAQEALNTLNKNNL 3244
            |:..|:.:|:|.......:|....  |:.:.|||  ..|:.|..:|.|.|.:|..||:||...::
 Frog  2597 VIERESIEVAKTEKVVKADEAVAN--EQAMAAKAIKDECDSDLAQALPILESALAALDTLTAQDI 2659

  Fly  3245 TELKSFGSPPDAVVSVCGAVLVLFSSK-GKIPKDRS---------WKACRAFMGNVDKFLDNLIN 3299
            |.:||..|||..|..|..|:.:|...| .||| |.|         |...:..:|.: |||.:|..
 Frog  2660 TVVKSMKSPPSGVKLVMEAICILKGVKPDKIP-DPSGSGKKIEDFWGPAKRVLGEM-KFLQSLHE 2722

  Fly  3300 YDKKHIHPDVIKAL-QPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLE 3363
            |||.:|.|..:..: :.||.:|||.|||:...|:||.|||.|||.::.:..|..||.||:..|.:
 Frog  2723 YDKDNIPPAYMNIIRKQYITNAEFVPEKVRNASTAAEGLCKWVIAMDSYDKVAKVVAPKKIKLNQ 2787

  Fly  3364 SEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLA 3428
            :|.|:|.|.:.|......|.|::::|..|:.:.:|...||...:::....:..:|.|.:|||||.
 Frog  2788 AESELKVAMEGLKKKQAALKEVQDKLAKLEQKLEENKQKKADLENQVDLCSKKLDRAEQLIGGLG 2852

  Fly  3429 TEKIRWMESVKVLTFG--IQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPS 3491
            .||.||  |:..:..|  ...|.||||:.|..::|.|.||.:||| :|...|....|:..  ||.
 Frog  2853 GEKTRW--SLTAIELGKLYINLIGDILVSSGIVAYQGAFTSSYRQ-MQTNEWTMLCKSKN--IPC 2912

  Fly  3492 TDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGT-G 3555
            ::.......:.:..:|..||..|||||..|.:|..|:..:.|:|||||||.|..||||....| .
 Frog  2913 SEDFSLANSLGEPVKIRAWNIAGLPSDSFSIDNGIIISNARRWPLMIDPQGQANKWVKNMEKTNS 2977

  Fly  3556 LVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFN 3618
            |.|::||..:::..:|..:..|:.:|:||:||.:||:|.|||.:|..|:|  ..:::||..|::.
 Frog  2978 LHVIKLSDPDFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYA 3042

  Fly  3619 SRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNH 3683
            ..||..:.|||.||||.||...:.||:||.:|.:|::||||..||..||||||..:..|..|...
 Frog  3043 PDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAE 3107

  Fly  3684 FKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYR 3748
            .|..||.:||.:|..|||:..|:|||.|.:..|..:|..|.||.||.|.|:.|..:||:.|..||
 Frog  3108 NKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALASEISVKQAVAEETEKKIDATRMGYR 3172

  Fly  3749 PAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVY 3813
            |.|..:||::|.:.||..|.|:||:||..|..:|..::..:..:|.|:.|::.|.|..|:..:..
 Frog  3173 PIAIHSSILFFSIADLANIEPMYQYSLTWFINLFVMSIDNSEKSEDLQKRLQILKDHFTYSLYEN 3237

  Fly  3814 TSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPY-MPNQTSN-FTWLTHVGWGGIRAL 3876
            ..|.|||:|||:|...|...::.:...::..|..|||.... :.|..|| .|||....|..:..|
 Frog  3238 VCRSLFEKDKLLFSFCLTANLMKHEQLIDEEEWKFLLTGGIGLDNPHSNPCTWLPQKSWDEVCRL 3302

  Fly  3877 NNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRS 3940
            :|..:|||:.||.......||...||..|.:..||.:|:.| ...||:.::||:|||::...::.
 Frog  3303 DNILLFKGIRKDFMRLRDGWKAVYDSLEPHHSTFPPDWQEKLGQFQRMLMIRCLRPDKIIPMVQE 3367

  Fly  3941 FIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVS 4005
            |:...||..:|:....:.|:.|.:|.....:.||||||.||:..:.|.....||.  .....|:|
 Frog  3368 FVSSYLGKPFIEPPPFDLSKAFGDSHCCAPLIFVLSPGADPMAALLKFADDQGFG--GGKLSSLS 3430

  Fly  4006 LGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGD 4069
            |||||..:|....|.|.:.|.||:|||.||...|:|.|||..|. :....|..:||:|::.|:.:
 Frog  3431 LGQGQGPIALRMTEKAIKEGSWVVLQNCHLATSWMPMLEKVCEELNPDTTHPDFRLWLTSYPSPN 3495

  Fly  4070 PAAHILPQGILESAIKITNEPPTGMMANIHKA--LDNFSD-ETLEMCSKETEFKAILFSLCYFHA 4131
                 .|..:|::.:|:|||.|.|:.:||.::  :|..|| |....|.|..|||.:|:.||:|||
 Frog  3496 -----FPVSVLQNGVKMTNEAPKGLRSNIIRSYLMDPISDPEFFTSCKKLPEFKKLLYGLCFFHA 3555

  Fly  4132 VVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDR 4196
            :|.|||||||.|||..|.||..|:.|||..|:.:|.....||::.|:|:.||..|||.:||||||
 Frog  3556 LVQERRKFGPLGWNIPYEFNETDMRISVQQLHMFLNQYEEVPYDALQYMTGECNYGGRVTDDWDR 3620

  Fly  4197 RLCRTYLEEFMQPELIDGELEYCQGFPAPGILKYT----GYHNYID--DNLP-SESPSLYGLHSN 4254
            |..|:.|.:|...|: :....|.  |.:.||. |.    .|.:||:  ..|| :.||.::|:::|
 Frog  3621 RALRSILNKFYNIEM-NKNPNYI--FDSSGIY-YAPPDGDYDSYIEYTKTLPLNSSPEIFGMNAN 3681

  Fly  4255 AEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVE 4319
            |:|....:.:::||..:...|.|    ||||...|.::::..:..|||.|.|:.|:....|.|..
 Frog  3682 ADITKDQSETQQLFDNILLTQSR----SSGGGAKSSDEVVFEVSADILSKLPSNFDTESAMRRYP 3742

  Fly  4320 DRSPYI----IVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWT 4380
              :.|.    .|..||..|.|.|::.::.|...:...:||.:.:|:.:|:::..:...::|..|.
 Frog  3743 --TTYTQSMNTVLVQEMGRFNKLLSTIRDSCINIQKAIKGLVVMSADLEEVVSSILKGKIPGMWM 3805

  Fly  4381 KLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLD 4445
            |.:|||:..|.|:.||.:.||:.|:.|..: ..|...||:|||..|:.||...|..|||...|:|
 Frog  3806 KKSYPSLKPLGSYVSDFLARLKFLQDWYEN-GTPPVFWLSGFFFTQAFLTGAQQNYARKYTIPID 3869

  Fly  4446 RMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQ 4510
            .:..:.:|.:  .:|...||.:|.||:|||::|||||.|...:.::|.|.|:..:||:::|..  
 Frog  3870 LLGFDFEVLE--DKEYKHAPEDGVYIHGLFLDGARWDRKTKKLGESFPKILYDTVPVMWLKPC-- 3930

  Fly  4511 DKQDIKN--VYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
            .:.||.|  .|..||||...|..|         ||....|.|.:....|...||.||.|
 Frog  3931 KRTDIPNRPCYIAPVYKTSERRGTLSTTGHSTNFVIAMTLPSDKPQEHWIGRGVALLCQ 3989

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 9/37 (24%)
DHC_N2 1368..1770 CDD:285579 116/416 (28%)
P-loop_NTPase 1903..2132 CDD:304359 138/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 51/142 (36%)
P-loop_NTPase 2510..2783 CDD:304359 78/277 (28%)
P-loop_NTPase 2860..3127 CDD:304359 110/277 (40%)
MT 3140..3480 CDD:289543 123/355 (35%)
AAA_9 3509..3722 CDD:289547 94/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 249/712 (35%)
dnah7XP_002937766.2 DHC_N2 728..1132 CDD:285579 118/435 (27%)
P-loop_NTPase 1259..1489 CDD:304359 138/230 (60%)
P-loop_NTPase 1573..1716 CDD:304359 52/143 (36%)
P-loop_NTPase 1910..2179 CDD:304359 78/271 (29%)
P-loop_NTPase 2279..2542 CDD:304359 109/269 (41%)
MT 2555..2901 CDD:289543 122/353 (35%)
AAA_9 2931..3146 CDD:289547 94/215 (44%)
Dynein_heavy 3286..3980 CDD:281078 251/716 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.