DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah9

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017953321.1 Gene:dnah9 XenbaseID:XB-GENE-5753499 Length:4330 Species:Xenopus tropicalis

Alignment Length:4585 Identity:2378/4586 (52%)
Similarity:3130/4586 (68%) Gaps:298/4586 (6%)


  Fly    10 PVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSF 74
            |.|.|.:|..:|:.||::||.|:|.|.:.|.|:|..:.|||:..::..::.|:|..|.|.|...|
 Frog     7 PSDKRLQFLEDYVLKTLKLKPDRWQKCVATEEYRQTLQEFLDKADQLLLVVTLNPAGLLVPVLEF 71

  Fly    75 PVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTN 139
            |...:.|..:|::..|. .|:.:.|.:||:.|||..:||.:.|.:.:||..|:|.|..|...|.:
 Frog    72 PKGSKNKAVFFLKRSTS-PLSADAMKSSLIYGDLSYSPLDHFSAVVEEVVVPILANQKNHQNWPH 135

  Fly   140 VIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDI---------SVVNP 195
            |:::|:.....::::....|.|.|..:|:.|||...::|          |.         ..::.
 Frog   136 VVSDDVTRHVNQLKSRTFVMVGQVKGKTLLPLPAGSEKV----------DYIDNENEKNNDELDR 190

  Fly   196 LMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIK 260
            .|.|::|..:::|...|..::..|:.|.:...:| |.|.|...||::|..:||.:..||...|::
 Frog   191 TMIHAIESAIIQWSHQVHGVLKKKSSEPLLQGKN-PNPNAEIDFWKNRYADLECIHNQLRMTRVR 254

  Fly   261 TIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPLML 325
            .:..:||::||.:..:::.:.          ||:                               
 Frog   255 KMAELLERVQSCYFPAFKALF----------RDV------------------------------- 278

  Fly   326 TIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQHLEYYK 390
                                                                   :.:.|.:|  
 Frog   279 -------------------------------------------------------VAVSHCKY-- 286

  Fly   391 LIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIVMGG 455
                                              |.|.||    .|:|..|..|..||||||..|
 Frog   287 ----------------------------------LSKSLV----TKNLLLTALDMMKLEKIVFAG 313

  Fly   456 LKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEK 520
            :||..:...:..:.:|:..:::.:::...:.:  |.:|..|:||...|:.:...|:|.:...|.:
 Frog   314 VKGNSLGQKVLTMYDEFQEVFKVFSDRSDDCL--DLQNKEFERDIFEFEQRVQDMDRRLGAIFCQ 376

  Fly   521 GLEDTHDLLLA-------GSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGL 578
            |.:|..:|..|       ||||.||:|.........:::..|::|:...|  .|..:::.||...
 Frog   377 GFDDASNLEYAFKLLDMFGSLLERPLIAAEAFDKYPLLISMFDQELDSAK--MIYNRHMQTAAEP 439

  Fly   579 NELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTK 643
            :....:...|.|:|.:.:.::||.|:...:.......:|..::..|..:...:..|:..::.:.:
 Frog   440 DNAQINQNMPPVAGNLKWTQQLRERLQNTYSNFRHVTHPCMESAEGAQMKQKYEEMMALLEKYKE 504

  Fly   644 MLLDKWTVECWQGIQQDITLTLIEKDEANEL-RVNFTERLIFALKDIKVVRLLGCD-VSVNLTKF 706
            .|.::|.....:..|.::|..||.:||..:| .|||..:|:..|:::|.::.|..: :.......
 Frog   505 KLYEEWCRTVSEKSQYNLTRPLIVRDENTKLIFVNFDPQLVSVLREVKYLQELRMETIPTEAGDI 569

  Fly   707 FCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFS-QRFI 770
            |..::........|...|..||.........|..||..::..|:.::|...:.:.|.|.. ..:|
 Frog   570 FSSKESYRTFTANLELTANRYNKVMRTILEVEFPLIEGQLQNIDVRLKEAEETLNWKANGVWEYI 634

  Fly   771 VMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAA 835
            ..:..||..|..|:..|::|::.|:..:::| .:|:|:|||.....||..|.|...|..|.:...
 Frog   635 QEVRDMVHDLERRVQKARDNVDEIQAIMKTW-VLPIFERKDGRKEALLSLDDRSDRLEKRYSLIR 698

  Fly   836 DTQRLIDLLMYVNLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDE 900
            ::...:..|:..|.:||               ..|..|| :|                       
 Frog   699 ESGTKLHALLKENRELF---------------SADPSSD-VW----------------------- 724

  Fly   901 EDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYL 965
                                                   :.|..|:|:::.:...:::..|   |
 Frog   725 ---------------------------------------KAYVDYIDDMVLDGFFNAIECS---L 747

  Fly   966 RMEVDN--RYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQ 1028
            :..:||  ......|:||:.|:|..|::|:...|:..|..|....||.:::|:..:.:|:.|:|:
 Frog   748 KCLLDNTDAKAGLAPLFEVQMDLLIPDMVFRPGLEHGSSDGLYDIIEGLINDIYRISALVPRLAE 812

  Fly  1029 DPTEVTNMNPYSFYD-ELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLS 1092
            ..|       :|.|. :::|.::|...|..||..::..:.:...:...|..::.|::.|:..::.
 Frog   813 HST-------FSHYQADMEDMADLADMRNAIMESVQNVMTSCTDYRNTFDHYAYLYVDDRKEFMR 870

  Fly  1093 EVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPP-LSVYKEQLDKFIELQDQIRTWETYEDFFV 1156
            :...:|..||.:|.:|.|:    .||.    |.|| |..:|||:|.:.::.::|...|....|..
 Frog   871 QFLLYGHVLTAEEIEAHAE----DGVP----ETPPSLQQFKEQIDSYEKIYEEIGRVEPVNIFDC 927

  Fly  1157 FLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKI 1221
            ::|::...||.|:|:.|.:|..:||..||:.|.|||.:|::|:..|...|..:|::.|:.|||:|
 Frog   928 WMRVDAQPFKSALLNVVKRWSLMFKQHLIDHVTNSLADLEEFIKVAERGLSKQLKEGDYNGLVEI 992

  Fly  1222 LSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIA 1286
            :..|..:.|:|...|.:|:|||:.|:||:.|:.|..|....|:.|||:.|..:|::|.|.||.:|
 Frog   993 MGHLMAVKERQANTDDLFEPLKQTIELLKVYDQELPDEVYKQLEELPEKWNNIKKMAITVKQQVA 1057

  Fly  1287 PIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAES 1351
            |:|:.:|.|:.:.....|...:.:|:.|..:..|....:|.|:.:|..::|:.|:|....|:.||
 Frog  1058 PLQANEVALLRRNCATFDVEQHKFREAFRKQAPFRFDSISPYQTLDAKNVEIKAMESTMSSIYES 1122

  Fly  1352 AVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGREL 1416
            |.|||:..||..:::.||.::.|:|.:||....::|.:|||:.|.|::|::||||.|||||.:::
 Frog  1123 AALFEVNIPDYKQLKQCRKEVCLLKELWDMIFLVKSNMNDWQTTRWREINVENMDLECKKFAKDI 1187

  Fly  1417 RGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDL 1481
            |.|||.||.|:.|..::..:||::||||||.||||||||:|||.:|||.|.|:|:||:.|||.||
 Frog  1188 RNLDKEMRAWDAFTGLDNQVKNILTSLRAVAELQNPAIRERHWSQLMQATGVRFTMDEDTTLADL 1252

  Fly  1482 IDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLE 1546
            :.||||.:|:||:.||||:||||.|||.|:::.|.|.:|.|..:.|.|||:.|:|:.||||||||
 Frog  1253 LKLNLHNFEDEVRGIVDKAVKEMGMEKVLKELDTTWCSMNFNYEPHPRTSVPLIKSDEELIETLE 1317

  Fly  1547 DHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPE 1611
            |:|.||||:.:|||||||..||..||.:||.||.:|..||||||.|.:||||||||:||||||||
 Frog  1318 DNQVQLQNLMTSKYIAFFLEEVSGWQKKLSTADSVISIWFEVQRTWSHLESIFIGSDDIRSQLPE 1382

  Fly  1612 DSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSY 1676
            ||.||:.||.:||.|....|...||:.:||:.|  |||.||.:.:.|.||||||.:||:||||::
 Frog  1383 DSSRFEGIDTDFKELANDANKTPNVIEATNKPG--LYERLEGIQERLSLCEKALAEYLDTKRLAF 1445

  Fly  1677 PRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNLI-----SGSKNAAGMVAKELEEYVP 1736
            |||||:||||||||||||.||.||.|||:||:|:|.|:...     |.||...||.:|| :||||
 Frog  1446 PRFYFISSADLLDILSNGTNPQLVMRHLSKLFDNMAKMKFQEDSDGSQSKMGLGMYSKE-DEYVP 1509

  Fly  1737 FLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTE 1801
            |.|.|||||:||.||||:.|.||.|:|.::..::|.|:.|||..|:|::|||.||..|||.||||
 Frog  1510 FNEPCDCSGQVETWLNRVLDTMRATVRHEMTEAVTAYEEKPREQWLFDYPAQVALTCTQIWWTTE 1574

  Fly  1802 TNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIA 1866
            ...:||::::.|||.:|||.|||:.|||.||.:|:|.|:..:|||||||||||||:||||..:||
 Frog  1575 VGISFARLEEGYENGMKDYFKKQVNQLNTLITMLIGQLSKGDRQKIMTICTIDVHARDVVSKMIA 1639

  Fly  1867 KKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSL 1931
            :|::...||.|.||||||||.:...||||||||||.|.|||||||||||||||||||||||||||
 Frog  1640 QKIDNAQAFVWLSQLRHRWDDQKKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSL 1704

  Fly  1932 HLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFN 1996
            ||.|.|||||||||||||||||||||||:|||||||||||||||.|:|:|||:||||||||||||
 Frog  1705 HLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFN 1769

  Fly  1997 RISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALY 2061
            |||||||||||||||.|||||:.||:.|:||||.|.|..:||:|||||||||||.|||||||||:
 Frog  1770 RISVEVLSVVAVQVKSIQDAIRDKKKRFNFLGEEINLIPSVGIFITMNPGYAGRTELPENLKALF 1834

  Fly  2062 RPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAG 2126
            ||||||||||.||.|||||||||.|||||||||||||.|||||||||||||||||||||||||||
 Frog  1835 RPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAG 1899

  Fly  2127 ALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSAL 2191
            :|:|.|..|||||||||||||||||||||||:||||||||||||||||||||:.|||:.:|::.|
 Frog  1900 SLKRGDPDRPEDQVLMRALRDFNIPKIVTDDMPVFMGLIGDLFPALDVPRKRDLEFESFVKQAVL 1964

  Fly  2192 DLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAV 2256
            |||||.||.|:||:||||||.||||||||:|.||||||:|.|:||||||..||:|.:.|||||||
 Frog  1965 DLKLQAEDNFVLKVVQLEELLAVRHSVFIVGNAGTGKSQVLKSLNKTYQIMKRRPVWTDLNPKAV 2029

  Fly  2257 TNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTL 2321
            ||||||||:|||||||||||||.:||:.||:...|||||||||||||||||||||||||||||||
 Frog  2030 TNDELFGIINPSTREWKDGLFSSIMRELANITHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTL 2094

  Fly  2322 ASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLN 2386
            ||||||.|...|||:|||:.|||||||||||||||||||.||||.|.:.||:..|...||.:.|.
 Frog  2095 ASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINPADLGWNPPVTSWIDKREIQSERANLT 2159

  Fly  2387 VLFDKYVPPLLDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVW 2451
            :|||||:|..||..|||.:.|.|:.:.:.:||.||||:.:||.:|.|.||||:.||:||||..||
 Frog  2160 ILFDKYLPLCLDTLRTRFKKIIPVPEQSMVQMLCYLLECLLTKENTPPDCPKELYELYFVFAAVW 2224

  Fly  2452 GFGSSLFQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDL 2516
            .||.::||||::|:..|||||::.|:|.:|||..||:|.:|||.|:|||.||:.|:|:||.|.::
 Frog  2225 AFGGAMFQDQLVDYRVEFSKWWVTEFKTIKFPSQGTVFDYYIDPESKKFEPWSKLIPKFEFDPEM 2289

  Fly  2517 PLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFY 2581
            |||:.||:|.||.|:|:|||.|:|...|:||:|.:|:||::|:..|||:|.||:|.:.|||||:|
 Frog  2290 PLQACLVHTNETIRVRYFMDKLLERRRPVMLVGNAGTGKSVLVGDKLSSLDSDEYMIKNVPFNYY 2354

  Fly  2582 TTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYD 2646
            |||.|||.:||||||||:||||||.|.|::|||:|||||||||.|.||||||||||.|||.||||
 Frog  2355 TTSAMLQAVLEKPLEKKSGRNYGPPGTKKLIYFIDDMNMPEVDTYGTVQPHTLIRQHMDYGHWYD 2419

  Fly  2647 RQKMTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHM----- 2706
            |.|:::::|.....|:||||:||||||:||||||||.||::.|..|||..|.|:||:||:     
 Frog  2420 RGKLSMKEIMNVQYVSCMNPTAGSFTINPRLQRHFCVFALSFPGTDALSTIYNTILTQHLKMGNF 2484

  Fly  2707 DNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCP 2771
            ..|:||..:.:|.|       |::.|.|:.||||||||||||.|||||::|||.|:|:|..|...
 Frog  2485 SGPLQKSTQQLINL-------ALSFHQKITSSFLPTAIKFHYIFNLRDLSNIFQGILFSTPECLK 2542

  Fly  2772 NSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVYAQPL-IYCHFAKGL 2835
            ....:::|::||..|||.||:::..|.::|.|:.:::|:|..:.:.:.:...:.: :|||||.|:
 Frog  2543 VPQDLVKLYLHESNRVYRDKMLEEKDFDTFDKMQTEMVKKFYDDMEEMLEQTKTMNMYCHFASGV 2607

  Fly  2836 TDIKYMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGG 2900
            .:.||||:..|:.|..:|.|..|.||:....|:||||:|||.|:|||:|||||.||.|||:||||
 Frog  2608 GEPKYMPVQSWESLNKILVETLDNYNEVNAVMSLVLFEDAMCHICRINRILESPRGNALLVGVGG 2672

  Fly  2901 SGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFL 2965
            ||||||||||:||||||||||.|.|.|.:.|||.::|..|:|||||.....|||||::||.|:||
 Frog  2673 SGKQSLTRLAAFISSLDVFQITLRKGYGIPDLKVDLANQYIKAGVKNVGTVFLMTDAQVADEKFL 2737

  Fly  2966 VLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPV 3030
            ||||||||||:|.:||||||||||:::||||||..|::|.||||||:||::||..|||.||||||
 Frog  2738 VLVNDLLASGEIPDLFPDDEVENIISSVRNEVKSQGLMDTRENCWKFFIDRVRRQLKVALCFSPV 2802

  Fly  3031 GATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVN 3095
            |..||||||||||:||||.|||||||||:||||||||||.|...:...:...:|.|||:||.:||
 Frog  2803 GNKLRVRSRKFPAVVNCTAIDWFHEWPQEALESVSLRFLQETENIESSVKPSISKFMAYVHTSVN 2867

  Fly  3096 DISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQD 3160
            ::||.||:|.:||||||||||||.|.||..||.:|.|....:..||||||.||.|.:.:||.|:.
 Frog  2868 EMSKSYLSNERRYNYTTPKSFLEQIKLYQNLLDKKGKELSAKMERLENGLQKLNSTSAQVDDLKA 2932

  Fly  3161 VLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKA 3225
            .|..||||||.||.:||.||.|||.|.|.||:|:|.|.:|||.|..|.|:|..|.|.||||..||
 Frog  2933 KLAAQEVELKQKNDDADKLIQVVGVETENVSREKAIADEEEKKVAVIAEEVXRKQKDCEEDLAKA 2997

  Fly  3226 QPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNV 3290
            :|||.|||||||||||.|||||||||:||.||.:|..||:||.:..||:||||||||.|..||.|
 Frog  2998 EPALAAAQEALNTLNKTNLTELKSFGAPPLAVTNVTAAVMVLTAPGGKVPKDRSWKAARVVMGKV 3062

  Fly  3291 DKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVE 3355
            |.|||:||.:.|:.||.:.|||:|||:.|.||:||.|.:||.||||||||||||.:|::||..||
 Frog  3063 DGFLDSLITFKKESIHENCIKAIQPYLQDPEFNPEFIASKSLAAAGLCSWVINIVKFFEVYCEVE 3127

  Fly  3356 PKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIA 3420
            ||.:||.::..|:..|.:||:::..::..|.|.|..|..::::|.|.|.|||.||..||.||.:|
 Frog  3128 PKRQALNKANAELAAAEEKLSSIKAKIAHLNENLAKLTAKFEKATADKLKCQQEAEATALTISLA 3192

  Fly  3421 NRLIGGLATEKIRWMESVKVLTFGIQQ--LPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFK 3483
            |||:||||:|.:||.|||:  .|.:|:  |.||:|:|:.|:||:|.|||.|||:|.:::|.|...
 Frog  3193 NRLVGGLASENVRWAESVR--NFKLQESTLCGDVLLITAFVSYLGYFTRKYRQDLMDRMWRPYLG 3255

  Fly  3484 NSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWV 3548
            ..:.|||.|..:||..|:.|||.||.|.|:|||:||||.|||.||...||:|||:|||||||||:
 Frog  3256 ELKVPIPVTPSLDPLTMLTDDADIAAWQNEGLPADRMSTENATILTNCERWPLMVDPQLQGIKWI 3320

  Fly  3549 KTKYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDR 3613
            |.|||.||.|:|:.||.|||.:|||::.|.|:|||||.|::||||.|||||:.||||..:||||:
 Frog  3321 KNKYGEGLRVIRIGQRGYLDTLERALAGGEVVLIENIEESLDPVLGPLLGRETIKKGRYIKIGDK 3385

  Fly  3614 EIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLT 3678
            |.:::..||||||||||||||:||||||.|||||||||.||||||||.||.:||||||.:::.||
 Frog  3386 ECEYSPNFRLILHTKLANPHYQPEMQAQCTLINFTVTRYGLEDQLLAAVVSMERPDLEELKSNLT 3450

  Fly  3679 QQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSA 3743
            :|||.||||||.|||:||:|||||..|.|.|..||.|||.|||||.|||.||.|||:|..:|:.|
 Frog  3451 KQQNGFKITLKTLEDNLLSRLSSASGNFLGDTALVENLEITKKTAAEIEEKVQEAKVTEAKINEA 3515

  Fly  3744 REAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITF 3808
            ||.|||||.|||::|||:|||.||:|:||||||||:|||..|:.||...|.||.||.||||||||
 Frog  3516 REHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQQAVQKAPTDEVLKQRVNNLIDSITF 3580

  Fly  3809 CSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGI 3873
            ..|.||:|||||.|||.:..||..|||:...|:..||||||||:|..|..||...:|::..||||
 Frog  3581 SVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINSTELDFLLRYPAQPGLTSPVDFLSNQSWGGI 3645

  Fly  3874 RALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAM 3938
            :||:....|:.|::|||||.|||||||:||.||.||||.|||.|||:||||:||.||||||:||:
 Frog  3646 KALSTMDEFRNLDRDIEGSAKRWKKFVESECPEKEKFPQEWKNKSALQRLCMMRAIRPDRMTYAV 3710

  Fly  3939 RSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHS 4003
            |.|:||||||||:..||::|:.::|||.|.|.:||:|||||||||||||.|:.||::||:.|||:
 Frog  3711 RDFVEEKLGSKYVVGRSLDFATSYEESGPATPMFFILSPGVDPLKDVEKQGRKLGYTFDNCNFHN 3775

  Fly  4004 VSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAG 4068
            ||||||||||||.|:::|::.|||||||||||||:||.:|||::|......|.::|:|:||||||
 Frog  3776 VSLGQGQEIVAEQALDLAAKEGHWVILQNIHLVAKWLGTLEKRLEQLSEGSHQNFRVFISAEPAG 3840

  Fly  4069 DPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVV 4133
            .|..||:||||||::|||||||||||.||:|||||||:.:|||||||::|||:|||:||||||||
 Frog  3841 SPEGHIIPQGILENSIKITNEPPTGMHANLHKALDNFNQDTLEMCSKDSEFKSILFALCYFHAVV 3905

  Fly  4134 AERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRL 4198
            ||||||||||||||||||.|||||||.||:||||||.:||::|||||||||||||||||||||||
 Frog  3906 AERRKFGPQGWNRSYPFNTGDLTISVNVLFNYLEANAKVPFDDLRYLFGEIMYGGHITDDWDRRL 3970

  Fly  4199 CRTYLEEFMQPELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTV 4263
            ||||||||::.|:::|.|....|||.|..:.|.|||.||||.||:|||.|||||.||||||||..
 Frog  3971 CRTYLEEFIKSEMLEGALYLAPGFPIPRNMDYNGYHQYIDDTLPAESPYLYGLHPNAEIGFLTQT 4035

  Fly  4264 SERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVA 4328
            ||:|||.|.|:|||.:....|| .|::|:.:|:.:::||:|.|..|||.|||.:||:|:|||:||
 Frog  4036 SEKLFRTVLEMQPRDSSAGEGG-GVTREEKVKSTLDEILEKLPDEFNIPELMAKVEERTPYIVVA 4099

  Fly  4329 FQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSW 4393
            ||||||||.|.:|:||||.|||||||||||::|.||:|...:::|||||.|||.|||||.||..|
 Frog  4100 FQECERMNALTSEIKRSLRELDLGLKGELTMTSDMENLQNAIFLDQVPESWTKRAYPSMAGLAGW 4164

  Fly  4394 FSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWK 4458
            |.||:.|::|||.|..||.:||::||||||||||.||||||..|||||||||:|.|.||||||.:
 Frog  4165 FVDLLSRIKELETWTGDFALPSAVWLAGFFNPQSFLTAIMQSMARKNEWPLDKMTLQCDVTKKNR 4229

  Fly  4459 EELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPV 4523
            |:.::.||||||::||||||||||...|.|.|:.||:|.|||||::||||..|||:.:|||.|||
 Frog  4230 EDFSSPPREGAYVHGLFMEGARWDTPAGVIMDSRLKDLTPAMPVIFIKAVPVDKQETRNVYPCPV 4294

  Fly  4524 YKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLLQ 4558
            ||.|.||||:|||||||::|..|||.||||.||||
 Frog  4295 YKTRQRGPTYVWTFNLKTKENPSKWVLAGVALLLQ 4329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 107/575 (19%)
DHC_N2 1368..1770 CDD:285579 235/407 (58%)
P-loop_NTPase 1903..2132 CDD:304359 200/229 (87%)
P-loop_NTPase 2217..2352 CDD:304359 108/135 (80%)
P-loop_NTPase 2510..2783 CDD:304359 159/278 (57%)
P-loop_NTPase 2860..3127 CDD:304359 183/267 (69%)
MT 3140..3480 CDD:289543 193/342 (56%)
AAA_9 3509..3722 CDD:289547 147/213 (69%)
Dynein_heavy 3864..4549 CDD:281078 463/685 (68%)
dnah9XP_017953321.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.