DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah11

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017950422.1 Gene:dnah11 XenbaseID:XB-GENE-950720 Length:4472 Species:Xenopus tropicalis

Alignment Length:4621 Identity:2274/4622 (49%)
Similarity:3084/4622 (67%) Gaps:215/4622 (5%)


  Fly     1 MADEKEKKEPV-----DNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIF 60
            |.:.::::.||     |.|.:|..:.:.:.|::|.|||.|.:.......:|.:|....:...::|
 Frog     1 MMELEDEEAPVPPFWEDVRVQFMGDRIQQMMKIKTDKWIKFVEDETNEKIIRDFFELGDHVTLVF 65

  Fly    61 TINSGGQLYPSYSFPVRPRYKVAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFF 125
            :|...|.|..|....:..:.|..| ||...|.::..||....|:.|:|....:...|.|.:||..
 Frog    66 SIGPNGILTASKEITMNTKSKTVY-IRKKKPANIGMENYKTDLMFGELACASINQTSALVEEVLV 129

  Fly   126 PLLNNTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDI 190
            |:|:|..|.:.|....:.||....:.|:|.:..::||:..:|..|:|        ....|...::
 Frog   130 PILSNKKNHLSWPQFTSLDMDQHVEYMKNKMHVIQGLISGKTHLPIP--------TVATITEQNL 186

  Fly   191 SV-------VNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLE 248
            :|       |.....|:.|.:::||...:.:::...:.:.:....: |.|.|...||:.|.:||.
 Frog   187 NVTSNKENHVQRAALHAFESILIKWSYQIVEVLERDSSQPLLQGLD-PGPHAELKFWKERRDNLT 250

  Fly   249 NLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDM 313
            .:.|||....::.:..:|:..:|.:..::..||..|.::|.||.||...||.|:..:...|..|.
 Frog   251 CIYEQLQAPAVQKMASILQDTESAYYPTFTNIVCEVKKALIEAEDIDLHLSTLRNHIKLLEETDF 315

  Fly   314 DENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKK 378
            .:....:.||:.||.|:|.||:.::....:.:....|.|.||:.....:.|:.:|:.:.:|:.:.
 Frog   316 PQIYILLPPLLHTICLIWAHSKCYNIPARVIVLLQEFCNLLIEQAKTYLSPEDLFKAEPEESLEH 380

  Fly   379 LDINMQHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVR 443
            :...::.|:.:|..:...|.||:.:....| ..:.|.:..:.:|.:.|:||.||.:::|:|..:.
 Frog   381 VQAALKVLQSFKHAFFTHRASLQTYYTDRT-QFKAWDFRSEMVFAKFDRFLERLLKIEDIFVIML 444

  Fly   444 DFQKLEKIVMGGLKGRQIT---FALEKILEEYNSIYREWTNIQYNPIDP-DAENSLFQRDRLSFK 504
            :||||||:..||.||:.:.   |.|.:..::.:.:::|.|      :|| |..|..|:::...||
 Frog   445 EFQKLEKLEFGGKKGKALNEKIFNLNEEFQDNSKVFKEST------LDPTDRNNKEFEQEYSDFK 503

  Fly   505 AKT-DVMERMVS-----FQFEKGLEDTHDLLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVK 563
            ||. |...|:.|     |....|||....||....|.|.          ..||:|.|.       
 Frog   504 AKVLDCDTRIASLLSEAFNDSSGLESAFKLLAICGLFLE----------RSVILDIFS------- 551

  Fly   564 KEFINFKNVFTALGLNELPTDDC-------------------FPKVSGAISFLKKLRHRIIGLHK 609
                  .|.||.|.:.:...|.|                   .|.|:|.:.|.::::.||.....
 Frog   552 ------PNYFTLLQMYDKELDRCKLLYDAHVKQLENYAVHRNMPAVAGTLKFTREIKDRIQISWS 610

  Fly   610 EHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWT----VECWQGIQQDITLTLIEKDE 670
            ......:...::.....|...:..|:..:|.:...:.:|||    .||...:.:.:   |:..::
 Frog   611 NFRFIHHLSMESPEASSVYQKYMEMMTLLDQYEDSVYEKWTSKVDEECEFNLDRPL---LVRNND 672

  Fly   671 ANELRVNFTERLIFALKDIKVVRLLG-CDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERA 734
            ...|.|||..:||..|::::.::... .|:.......|.:.:.|.:....|.::..|||......
 Frog   673 DGLLSVNFDPKLIAVLREVRYLQKQSQADIPKEALAIFDKREMLHKYIASLDQLVFWYNKLKRTV 737

  Fly   735 HPTEKRLIAAEMILIEEQMKPLLDFIKW---NAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKE 796
            ...|..||..::..|:||::...:...|   |.:.  :||.:..:|:.|..|:..:::|:..:::
 Frog   738 LEVEYPLIKDDLKNIDEQLRESEERYTWKDDNCWD--YIVKVKSVVQDLEKRVQTSKDNIITMQQ 800

  Fly   797 SIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPRRYSL 861
            .::.|.:..||.|||.....|::.|.:..|::                                 
 Frog   801 IMKVWAEQWLFSRKDNRKETLINLDDKNEIVN--------------------------------- 832

  Fly   862 PPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYE 926
                                           ||.:.|.|:.     .:.||.:.|.:       |
 Frog   833 -------------------------------KKYQTIQEDS-----VKIQSLAMENM-------E 854

  Fly   927 LLK---GLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMELQE 988
            |||   ||..     ::.|..|:|.|:.:.|.::::.|.|:.....|.|.: ..|:||..|.|..
 Frog   855 LLKATPGLDS-----WKMYVEYIDTIVTDGLYNTILHSLTFFMENTDVRLK-PAPLFEAQMILAS 913

  Fly   989 PNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDK 1053
            ..:::..:|......|....:|.:|.|:..|...:||:|:      ::...::.:::.|.::|..
 Frog   914 TEIIFKPSLQKEDGDGLYDLVEEMLSDIFKMSGQVKRIAK------HLETDNYQNDMDDMTDLAA 972

  Fly  1054 QRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGV 1118
            .|.|||.::...:..|..:...:..:|.||..|:..::.:...:|..||.||.:|.||    .||
 Frog   973 IRQEIMERVTGVIIKVTDYRSTYDSYSYLWTDDRQEFMRQFLLYGHVLTSDEIEAHAD----DGV 1033

  Fly  1119 KLLGLEYPP-LSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKL 1182
            .    |.|| :..:|||:|.|..|...:.:.:..:.|..:.|:::..||.::|..:.:|..:||.
 Frog  1034 P----ETPPTIDQFKEQIDIFENLYVLMSSSDDTKVFERWFRVDIKPFKTSLLVIIKKWSWMFKE 1094

  Fly  1183 DLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIID 1247
            .|:..|.:||.||::|:.|||.:|..::.:.|:..||.::.:|..:.::|...|.:|:|||:.|.
 Frog  1095 HLVRFVIDSLAELEEFIKEANAILLKKVPEGDYSALVAVMELLLAVRDRQMATDELFEPLKQTIS 1159

  Fly  1248 LLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRK 1312
            ||..|..:..|....|:.|||:.|...|:||.:.|..:||:|..:|.||.||....|.....:|:
 Frog  1160 LLESYGQKLPDQIYVQLEELPEKWNHTKKLAVSVKHDVAPLQISEVTLIRKRCTAFDMKQIHFRE 1224

  Fly  1313 KFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKI 1377
            :|.....|.....:.|.|:|:::..|.|:||.:..|.:||.||::..||..:::....::||:|.
 Frog  1225 RFSLDAPFSFNAQNPYSLLDKANRALQAMEEEKLHLQQSADLFDVAVPDYKQLKKSSKEIKLLKE 1289

  Fly  1378 MWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGR-----ELRGLDKAMRTWEPFIFMEASLK 1437
            :||...|::|:|.||.||||::|::|.||.|.::|.:     :|..|||..|:|:.:..::.|:|
 Frog  1290 LWDLIHTVRSSIVDWVKTPWRQINVEQMDMELRRFAKASSTADLLSLDKHTRSWDAYSGLDLSIK 1354

  Fly  1438 NLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVK 1502
            ||:|||||:|:|||||||||||.:||..|||:|:|.:.|||.||:.|.||:.|:||:|||||:||
 Frog  1355 NLITSLRAITDLQNPAIRDRHWHQLMNATKVQFTMTEQTTLSDLLALQLHKVEDEVRNIVDKAVK 1419

  Fly  1503 EMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHE 1567
            ||..||.|.:|:..|.:|||..:.|.||...|::..|.|.|||:::|.|||.:..|||:.:|..:
 Frog  1420 EMGTEKILIEISQTWTSMEFSYEHHHRTGTPLIQTDELLFETLDNNQVQLQVIMQSKYVEYFIEQ 1484

  Fly  1568 VRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNA 1632
            |..||.||:.||.:|..|.||||.|.:||||||||.|||:|||.|::||..:|.:||.|:.:...
 Frog  1485 VTSWQKRLNLADSVIYIWMEVQRTWSHLESIFIGSADIRNQLPGDAKRFKGVDADFKDLMFETEK 1549

  Fly  1633 DRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNP 1697
            .|||:.:|||  ..||:.||.|...|.||||||::|||||||::|||||||:||||||||.|..|
 Frog  1550 IRNVLDATNR--PDLYKTLEDLQLRLSLCEKALSEYLETKRLAFPRFYFVSAADLLDILSKGTQP 1612

  Fly  1698 ALVARHLTKLYDSMGKLNL-ISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDT 1761
            ..|.|||.||:|::..|.. .||...|.||.:|| .|:|||..||.|.|:||.||.::.:.|.:|
 Frog  1613 KQVTRHLAKLFDNIADLQFQDSGENEAQGMYSKE-NEFVPFSVNCKCIGQVEHWLKKVEETMCET 1676

  Fly  1762 LRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQIT 1826
            :...:..|:..|:.|||..|:|::|||.||..:||.||.:...||.::::.:|.|||||.||||.
 Frog  1677 ICCHITESVAAYEDKPRDQWLFDYPAQVALTSSQIWWTIDVGIAFERLEEGFETALKDYIKKQIA 1741

  Fly  1827 QLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDD 1891
            |||.||.:|||:|:|.:||||||:||||||:||||..:||.||.....|.|.||||||||.|...
 Frog  1742 QLNALINMLLGELSAGDRQKIMTMCTIDVHARDVVAKLIAHKVTNAQDFAWLSQLRHRWDEKQKH 1806

  Fly  1892 CFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGR 1956
            ||.|||||||:|.|||||||||||||||||||||||||||||.|.||||||||||||||||||||
 Frog  1807 CFVNICDAQFQYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGR 1871

  Fly  1957 ALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKK 2021
            |||:|||||||||||||||:|:|:|||||||||||||||||||||||||||||||.|||||::|:
 Frog  1872 ALGVMVYVFNCSEQMDYKSVGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRNKR 1936

  Fly  2022 QTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQE 2086
            :.|.||||:|.|:.:||:|||||||||||.|||||||||:|||||||||..||.|||||||||.:
 Frog  1937 ERFLFLGENITLKHSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDIELICEIMLVAEGFID 2001

  Fly  2087 ARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIP 2151
            ||.||||||||||||||||||||||||||||:||||||||:|:|.|..|||||||||||||||:|
 Frog  2002 ARPLARKFITLYTLCKELLSKQDHYDWGLRAVKSVLVVAGSLKRGDSSRPEDQVLMRALRDFNLP 2066

  Fly  2152 KIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRH 2216
            ||||||||:|||||.||||||||||||:..||.::|:|.|:|.||||:.||||:||||||.||||
 Frog  2067 KIVTDDVPIFMGLISDLFPALDVPRKRDFSFEQMVKQSTLELHLQPEESFILKVVQLEELLAVRH 2131

  Fly  2217 SVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILM 2281
            |||::|.||||||:|.:||||||.|:|:||.:||||||||:.|||||.::|:||||||||.|.||
 Frog  2132 SVFVVGNAGTGKSKVLRTLNKTYLNRKQKPVWNDLNPKAVSTDELFGFIHPATREWKDGLLSSLM 2196

  Fly  2282 RDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTAT 2346
            |:||||...||||||||||||||||||||||||||||:||||||||.||..|||||||..|||||
 Frog  2197 REQANLTHEGPKWIVLDGDIDPMWIESLNTVMDDNKVMTLASNERIPLTPTMRLLFEIHHLRTAT 2261

  Fly  2347 PATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTR-LRSITPI 2410
            |||||||||||:|||||||.|::.||:.||:|.:|.:.|.:||||||||.||.|||. |:::|||
 Frog  2262 PATVSRAGILYMNPQDLGWNPYVTSWIETRSNQTEKANLTILFDKYVPPCLDQFRTGFLKTVTPI 2326

  Fly  2411 SDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLN 2475
            .:.:.:|..|.|||.:|...|||.|..::.||:||||..:|.||.:|.:||:.|:..|||:|:..
 Frog  2327 LENSMVQTLCSLLDCLLNTDNVPPDSARELYELYFVFACIWAFGGALQRDQLTDYRVEFSRWWTK 2391

  Fly  2476 EYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIE 2540
            |.|:||||..||||.:::|.:.::|..|...||.||:|:|..:|:..|:|||||.|.:|.|.||:
 Frog  2392 EMKSVKFPAQGTIFDYFLDSKARRFISWAERVPSFEMDIDSTMQAVFVHTAETTCLGYFTDLLIQ 2456

  Fly  2541 ADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGP 2605
            ...|:||:|.:|.|||:.::.:|::|| |.|.:..||||:||||..|||:|||||||||||||||
 Frog  2457 KSKPVMLVGNAGVGKTVFLSDRLASLP-DHYMIAKVPFNYYTTSSALQRVLEKPLEKKAGRNYGP 2520

  Fly  2606 IGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGS 2670
            ||||:::||:||||||||||:.||||||||||.:||.|||:||||:|::||.|..||||||:|||
 Frog  2521 IGNKKLVYFIDDMNMPEVDKFGTVQPHTLIRQHIDYGHWYERQKMSLKEIHNCQYVACMNPTAGS 2585

  Fly  2671 FTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKV 2735
            |||:.||||||..||||.||.||:..|.:.|||.|...  ..|..:|:|...:::...|.|..|:
 Frog  2586 FTINQRLQRHFTVFAVNFPSNDAVEVIFSKILSFHFKQ--HAFSPSVLKAGTSIIQATIWLSHKM 2648

  Fly  2736 VSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINS 2800
            |.:||||||||||.||:|:|.|||.|:|::.||.....:.:|.||.||..||||||:|:..|.:.
 Frog  2649 VQNFLPTAIKFHYIFNIREITNIFQGILFATSECLKQPSDLIHLWFHESSRVYGDKMVESKDSDL 2713

  Fly  2801 FKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIKYMPISGWDRLKSLLDEAQDRYNDYIG 2865
            ||:|:.|.|::..|||...|...||||:||||.||....|||:.||:.|:..|.||.:.||:...
 Frog  2714 FKRILQDTVQRYFEGVEHQVFSQQPLIFCHFANGLDTQSYMPVKGWEVLRKTLAEALNSYNELSA 2778

  Fly  2866 AMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVS 2930
            |||||||:|||.||||||||||..|||||||||||||||||::||::|.||:||||.|...|||.
 Frog  2779 AMNLVLFEDAMQHVCRISRILEMPRGYALLIGVGGSGKQSLSKLAAYIGSLEVFQITLKNGYSVQ 2843

  Fly  2931 DLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRN 2995
            |||.::|.||::.|.|.....||:||::|..|:||||:|||||||:|.:||.::|.::||:.:|:
 Frog  2844 DLKVDLANLYIRTGAKNMPTVFLLTDAQVPDERFLVLINDLLASGEIPDLFTEEETDSIVSGIRS 2908

  Fly  2996 EVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQA 3060
            ||:.||:.|::||||.:|:|:||..|||||||||||.|||||:|||||:||||:|||||||||:|
 Frog  2909 EVRGLGLNDSKENCWNFFLERVRHQLKVVLCFSPVGCTLRVRARKFPAIVNCTSIDWFHEWPQEA 2973

  Fly  3061 LESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSK 3125
            |:|||.||:.:|..:...:...:|.|||:||.:|||:|..||...|||||||||||||.|.||..
 Frog  2974 LQSVSRRFIQDIEGIEPGVKDSISQFMAYVHTSVNDMSIKYLQYEKRYNYTTPKSFLEQITLYKN 3038

  Fly  3126 LLHEKVKANLDRRL-RLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEK 3189
            || ||.:..|.:|: .|.|||.||.:...:|:.|:..|..||.||:.:||:|:.||..:|.:.||
 Frog  3039 LL-EKKRRELSQRMEHLMNGLQKLTTTASQVEDLKVKLASQEAELQQRNQDAEALITKIGRQTEK 3102

  Fly  3190 VSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPP 3254
            ||:|:|.|..||:.|..|:|:|:.|.|.||||..||:||||||..||:||||.||||||:|.:||
 Frog  3103 VSQEKATADAEEQKVASIQEEVSVKQKDCEEDLSKAEPALIAATAALDTLNKTNLTELKTFPNPP 3167

  Fly  3255 DAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIK-ALQPYIL 3318
            .||.:|..||:||.:.||::||||||||.:.|||.||.||..||.|||:|||.:.:| |.:.|:.
 Frog  3168 IAVTNVTAAVMVLLAPKGRVPKDRSWKAAKVFMGKVDDFLQALIKYDKEHIHENCLKVAKEQYLN 3232

  Fly  3319 DAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLT 3383
            |..|||:.:..||.||||||:|||||.::|:||..||||.:||.::.:::|.|.:||||:..:|.
 Frog  3233 DPGFSPDLVRTKSFAAAGLCAWVINIVKYYEVYCDVEPKRKALGQANEDLKGATEKLTAIRKKLH 3297

  Fly  3384 ELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQL 3448
            :|:..|..|...:::|.|:|.:||:|.::|..||::||||:.||.:|.|||.||:|......:.|
 Frog  3298 DLDNNLKKLTHSFEKATAEKVRCQEEVNRTNTTIEMANRLVKGLESENIRWSESIKSFKAQEKTL 3362

  Fly  3449 PGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQ 3513
            .||:|:.:.|:||||.|::.|||||.|.:|:|...:.:..||.::|:||..|:.|||.:|.|||:
 Frog  3363 CGDVLLTAAFVSYVGSFSKRYRQELMENIWIPFLTSQKVVIPVSEGLDPIAMLTDDATVAGWNNE 3427

  Fly  3514 GLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGS 3578
            ||||||||.|||.||:.:||:|||||||.|||||:|.||||.|.|:.|.|:.||..:|.|:::|.
 Frog  3428 GLPSDRMSTENATILINAERWPLMIDPQQQGIKWIKNKYGTVLKVINLGQKGYLQTIETALASGD 3492

  Fly  3579 VLLIENIGENIDPVLNPLLGRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTT 3643
            .:||||:.||:||||:|||||..||:|..:||||:|.::|..|||||||||||||||||:|||||
 Frog  3493 TVLIENLAENVDPVLDPLLGRNTIKRGRYIKIGDKECEYNQHFRLILHTKLANPHYKPELQAQTT 3557

  Fly  3644 LINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLE 3708
            |||||||.|||||||||:||.:||||||.:::.||:|||.|||.||.|||:||.|||:|..:.|.
 Frog  3558 LINFTVTTDGLEDQLLADVVSIERPDLEELKSMLTKQQNDFKIELKRLEDELLIRLSAAEGSFLG 3622

  Fly  3709 DVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQF 3773
            |:.||..||.||.||.|||.||.|||...::|:.|||.||.||.|||::|||::||.||||||||
 Frog  3623 DMELVEKLESTKVTAAEIEHKVVEAKENEIKINEAREHYRAAAARASLLYFIMSDLSKINPIYQF 3687

  Fly  3774 SLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNL 3838
            |||||.|||:.|:.:|..:|.:.:||..|.:.||:.:|:|||:||||:|||.||:|...|||:..
 Frog  3688 SLKAFNVVFHKAIGRAEQSEDVTERVAKLTECITYSAFLYTSQGLFEKDKLTFLSQTAFQILLKQ 3752

  Fly  3839 GEVEPTELDFLLRFPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSE 3903
            .|::..|||.|||||...:..|...:|:...|..|:.::....||||::|||||.|||||||:||
 Frog  3753 KEIDSLELDVLLRFPIENSYKSPVDFLSVQSWSAIKMISLLDEFKGLDRDIEGSAKRWKKFVESE 3817

  Fly  3904 SPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPE 3968
            :||||:.|.:||.|:::|:|.::|.:|||||:||:|:||||||||||::....:|::::||:||.
 Frog  3818 NPENERLPQDWKNKTSLQKLILLRALRPDRMTYAIRNFIEEKLGSKYVEEARPDFAKSYEETSPA 3882

  Fly  3969 THIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNI 4033
            |.:||:|||||:||||||.|||.|||:.|...||::|||||||.|||.|:|.|:|.||||||||:
 Frog  3883 TPVFFILSPGVNPLKDVEALGKKLGFTIDSGKFHNISLGQGQEKVAEEAMEKAAQQGHWVILQNV 3947

  Fly  4034 HLVARWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANI 4098
            ||||:||.:|||.:....:..|..||:|:|||||..|..||:||||||::|||||||||||:||:
 Frog  3948 HLVAKWLGTLEKLLAQYSTGSHEDYRIFISAEPAPSPEEHIIPQGILENSIKITNEPPTGMLANL 4012

  Fly  4099 HKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLY 4163
            |.|||||..:|||||::|.|||.||||||||||.||.|.|||||||||.||||.|||||.|.|||
 Frog  4013 HAALDNFDQDTLEMCAREQEFKCILFSLCYFHACVAGRLKFGPQGWNRRYPFNSGDLTICVNVLY 4077

  Fly  4164 NYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGIL 4228
            ||||||.:|||||||||||||||||||||||||:||||||||||.|.:::||.....||.||...
 Frog  4078 NYLEANNKVPWEDLRYLFGEIMYGGHITDDWDRKLCRTYLEEFMNPAVLEGEKPLAPGFAAPPNQ 4142

  Fly  4229 KYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMT--GGSSGGETVSQE 4291
            .|:|||.|||:.||:|:|.|||||.||||.|||..|:.||:.:.|:||:.|  |..||   :|.|
 Frog  4143 DYSGYHEYIDEILPAENPVLYGLHLNAEIDFLTVTSDNLFKTILEMQPKNTLHGEGSG---MSVE 4204

  Fly  4292 DIIKNIIEDILDKTPTPFNILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGE 4356
            :.:|||:::||:|.|..||:||||.:..:|||||:|.||||||||.|..|::|||.||:||||||
 Frog  4205 EKVKNILDEILEKLPEEFNMLELMHKTTERSPYILVCFQECERMNILTQEIRRSLKELNLGLKGE 4269

  Fly  4357 LTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAG 4421
            |||||.||.|...|:.|.||:.|.||||||...|..|.:||:||.|||:.|..|..:|:.:||:|
 Frog  4270 LTISSDMEALQSSLFYDSVPDTWAKLAYPSSFSLGQWINDLLLRCRELDTWTQDLVLPAVVWLSG 4334

  Fly  4422 FFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMG 4486
            .|||||.||||||..|||||||||:|||..|||||.||:....|||||||.||||||||||::..
 Frog  4335 LFNPQSFLTAIMQSMARKNEWPLDKMCLTVDVTKKTKEDYGHPPREGAYICGLFMEGARWDIQTN 4399

  Fly  4487 TIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPTFVWTFNLKSRERASKWTLA 4551
            .||:|.||:|.|.|||:|::|:..||::::|.|:||:|:.:.||||:|||||||::|..:||.||
 Frog  4400 VIAEARLKDLTPLMPVIYVRAIPVDKKELRNTYDCPLYRTKTRGPTYVWTFNLKTKEPPAKWVLA 4464

  Fly  4552 GVCLLL 4557
            ||.|||
 Frog  4465 GVALLL 4470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 140/603 (23%)
DHC_N2 1368..1770 CDD:285579 206/408 (50%)
P-loop_NTPase 1903..2132 CDD:304359 197/229 (86%)
P-loop_NTPase 2217..2352 CDD:304359 106/135 (79%)
P-loop_NTPase 2510..2783 CDD:304359 157/273 (58%)
P-loop_NTPase 2860..3127 CDD:304359 168/267 (63%)
MT 3140..3480 CDD:289543 171/341 (50%)
AAA_9 3509..3722 CDD:289547 141/213 (66%)
Dynein_heavy 3864..4549 CDD:281078 427/687 (62%)
dnah11XP_017950422.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1463at33208
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.