DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah10

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_012824530.1 Gene:dnah10 XenbaseID:XB-GENE-5715441 Length:4649 Species:Xenopus tropicalis

Alignment Length:4831 Identity:1495/4832 (31%)
Similarity:2439/4832 (50%) Gaps:556/4832 (12%)


  Fly     3 DEKEKKEPVD-----NRPEFFWNYLTKTMRLK----------LDKWTKMIT----TNEFRDVIIE 48
            :.:::|||||     :........||.:...|          :||....|.    |..|.:...|
 Frog   100 ETEDQKEPVDTVSLLSSDAIVEKELTSSPDTKASVNERDEKTIDKEESSILLETGTGSFNEESPE 164

  Fly    49 -FLNNPN----KKRIIFTINSGGQLYPSYS-FPVRPRYKVA-YFIRYLTPLHLTDENMLNSLLIG 106
             |:..|.    ||::..|:     ||.|.: .|......:| ||:|. |...:.:.|.|..  ..
 Frog   165 VFVPVPMTKIFKKKVYRTV-----LYVSCNCIPEEFVDSIALYFLRN-TQETIPEPNDLQE--AN 221

  Fly   107 DLLP----------NPLANLSILCDEVFFPLL--NNTVNQVG---WTNVIANDMKTESQ------ 150
            |:||          |.|..|..:..:||.|||  |:..|..|   ...|..:.:.|||.      
 Frog   222 DVLPMFLEYGILNGNSLLMLKQIFSQVFMPLLSYNHHKNDNGSLQLEQVRQSGLDTESNGPEANR 286

  Fly   151 ------EMRN-------GIAQMKGLV--INRTIFPLPICMDEVMQAAPAIAMGDIS----VVNPL 196
                  |.|:       .:..|:..:  |.:||..|.   .|:....|.:.: ||.    .::.:
 Frog   287 HAETGLEFRSIQMIRDEFLMNMQKFLNHIQQTIQQLE---GEIRLEMPDLTL-DIESTQLALDQV 347

  Fly   197 MKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKE--NFPLPEAIFSFWESRLENLENLAEQLGDRRI 259
            :...||..|:.|    :..:::...|::..|.  |.||.|  ..||..|...|..|:|||....:
 Frog   348 IVEKLEQCVMNW----QTQISVALEEQLQKKPQGNGPLAE--IDFWRERNATLSALSEQLKLPLV 406

  Fly   260 KTIGFVLEKIQSIFEHSYRRIVELVLESLA----EARDITKCLSPLKRKMDKFETNDMDENRSDI 320
            |.|..||    ||.:....:.:||.:..||    ||.|..:.||.|:|...............|.
 Frog   407 KKILSVL----SIADPGVVQNLELTVNELAKYHVEAADNVRFLSTLERHFKNLAHGTGFSVVLDT 467

  Fly   321 RPLML-TIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKLDINMQ 384
            .|.|: .:.:||..||:::....|..........:.:.|.|.:...|:|:.:.:.|..|......
 Frog   468 VPSMMNALRMVWIISRHYNKDERMVPLMERIAWEIAERVCRVLNIRSLFRENKEAAKNKSQDAKH 532

  Fly   385 HLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQKL- 448
            .||.:|..|.|.|     .||..:...|.|.:.:..:|.:.|......::|.::...:.:|..: 
 Frog   533 TLELWKSSYFEVR-----AKIEASGRDQRWEFDRKRLFEKTDYLSSICQDLYNILQVLEEFCNIF 592

  Fly   449 ---EKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRL---SFKAKT 507
               .|.|.|..|      .::.:|...:.:.|...|:.::|.  :.:||  |:.::   .||.:.
 Frog   593 GPELKAVTGDPK------RIDDVLRRVDGLVRPMENLSFDPF--NIKNS--QQWKMVMEDFKNEV 647

  Fly   508 DVMERMV------SFQFEKGLEDTHDLLLA-GSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKE 565
            ..:|...      ||:..:..|...|:||. ..:..|..|.|.:....:.|::.:.:|:..|...
 Frog   648 HAIEGEAINFIDESFKTLRSAEAAFDMLLKFKHIRSREAINKQMMMKFNDILEQYAKEVDIVNSL 712

  Fly   566 FINFKNVFTALGLNELPTDDCFPKVSGAISFLKKLRHRIIGLHKEHELYEY----PLFDNERGGY 626
            |:..        |:..|.....|.|:|:|.:.:.|.:||     :|.:..:    .:...|||..
 Frog   713 FLKH--------LDNPPLYKNHPPVAGSIYWERSLFYRI-----KHTIVRFLEMEEMLSCERGKA 764

  Fly   627 VSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLI---------------------EKDE 670
            ....:..:.:::.::.....:.|.....|.:...:..:|:                     :::|
 Frog   765 AKAKYLEVARKMKEYEDKKYEMWKENTDQNLPSLLKRSLLVKMYSSGLIISGNTPFSELNADQNE 829

  Fly   671 AN------ELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYND 729
            |:      ...|||...|...:.:.|.:..:|..|.........:||       |.:|    |.|
 Frog   830 ADNGDTDFHFSVNFAPELWEIITETKHMEQMGFSVGELPRNVALQED-------KFLR----YTD 883

  Fly   730 TFERAHPTEKRLIA----AEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQEN 790
            ..:......::|:.    ||:.|::|.::.:     |..|...:        :.|:...:...:.
 Frog   884 DMKHMIAAYEKLMGSLSEAEIQLLDEHIRDV-----WKVFRSGY--------RRLNWNSLGIGDY 935

  Fly   791 LEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDI 855
            :....::|..:                      |.:::....||.|    |||            
 Frog   936 ITRCNQAISKF----------------------ESLVNKIQKNAKD----IDL------------ 962

  Fly   856 PRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSV---KFKKKREVIDEEDDLEEFEEEQSESEEE 917
                                      .||.:.|.   ||..|....|.....|.||....|..::
 Frog   963 --------------------------KLSAIESANLFKFMAKTTGTDLSGVKEFFEYIDIERAKD 1001

  Fly   918 IITPFHRYELLKGLSQEERAL-----------FREYEIYVDEIIAENLVDSVITSSTYLRMEVDN 971
            :.....:|..:..|..:...|           ..:|..:.::.|..:|...|:.:.......:  
 Frog  1002 VDILERKYSTIGQLLTKIEGLVVNTNTGKHPKMSQYYAHWEKRIYNSLTKMVLRNFQVFNTAI-- 1064

  Fly   972 RYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFF---IETILDDMNNMMSLLKRVAQDPTEV 1033
              ..:.|:|::...|..|.::...|.:...|.....:   :||....:..|.....:.....||.
 Frog  1065 --LGDVPLFQVETILSAPEIILQPNGNEIYKLTAQCYKGCMETTKRFVRWMNGTCIQCPPQKTED 1127

  Fly  1034 TNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFG 1098
            ..:...|||:::....::.:|...|...:...|.::..:...:..:..||..||:..:   :|| 
 Frog  1128 DEVVIISFYNDIYLNHQITEQARIINQNMHRILTSLTKYLNRWKRYRPLWKLDKAIVM---EKF- 1188

  Fly  1099 RNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMT 1163
                                   ....|....|.|:|..:.::..::......:| ...:||.:.
 Frog  1189 -----------------------AARRPSCVAYDEKLQFYSKISLEVTQQPLIKD-VQCIRLYLG 1229

  Fly  1164 GFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQI 1228
            .....|......|::.....|....:..|.:|:|.::..:..||  ...:..|.|..:|..:..|
 Frog  1230 PLAYTVQENARAWVNSLGHLLNESAREELYKLKDELESLSAQLK--TTPETLEDLKFVLGTIANI 1292

  Fly  1229 NEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMK-------VKRLAATTKQLIA 1286
            .:.....:..:..::|....|..||.||::.|....:.:|..|.:       |.......|....
 Frog  1293 RDISLTVEMRYRDIQERYRTLSMYNIEFEEEEKYLADRIPQIWEELFQESKLVDHSLGKVKNSFT 1357

  Fly  1287 PIQSYQVDLIEKRILLCDNMANTYRKK-------FLSKKFFFVPCLSCYELIDESDLELVALEER 1344
            .|...|::..:|::   .|.|..::.:       .|.|.   :..||.:|      .||...|:.
 Frog  1358 QITKDQIEDYKKKL---SNFAELFQTEGPGAVGDNLDKG---LQVLSAFE------KELAKYEKD 1410

  Fly  1345 QRSLAESAVLFEL---QGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMD 1406
            ::.||.:..||:|   ..|:.::|:.   ::|.::.:::.....:....:|.:|.|..::::.:.
 Frog  1411 RQELANAEKLFDLPITMYPELIQIQK---EMKGLQQIYEIYNAQKQAKEEWSQTLWANLNVQILL 1472

  Fly  1407 QECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFS 1471
            .....|.:..|.|.|.:|:.....::|:.:|....|:..:.:|:|.|:|||||.|||..|...|.
 Frog  1473 DGIDGFLKAFRKLSKDIRSLPVAFYLESKMKEFKESIPLLLDLKNEALRDRHWKELMTKTGTDFE 1537

  Fly  1472 MDDST-TLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEF-------GTDIHD 1528
            |:..| ||:::..:.||:|.:.:.:||..:|||:::||.:::|...|..|:|       ||  .|
 Frog  1538 MNPETFTLENMFAMELHKYADAISDIVASAVKELSIEKGVKEILDTWENMKFTVQRYIKGT--QD 1600

  Fly  1529 RTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQ 1593
            |.||  |...:|:::.|:|:...||:::.|:::..|.:.|:.|:..||...::|..|..|||||.
 Frog  1601 RGSI--LGTVDEILQILDDNAMNLQSISGSRFVGPFLNTVQQWEKTLSLIGEVIEVWMVVQRKWM 1663

  Fly  1594 YLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKML 1658
            ||||||||. |||||||:::::||.||:.||.::::...| .|::...::.::|.: |:.|.:.|
 Frog  1664 YLESIFIGG-DIRSQLPDEAKKFDNIDRIFKRIMSETVKD-PVIKRCCQASNRLSD-LQNLSEGL 1725

  Fly  1659 LLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL---ISGS 1720
            ..|:|:|||||::||.::|||:|:|..:||.||.: ::|..|..|:.|:||::..|..   .:|.
 Frog  1726 ERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGS-SDPTCVQEHIIKMYDNIASLKFQEGDNGE 1789

  Fly  1721 KNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFY-DHKPRHVWIFE 1784
            ..|..||:.| .|.:||.:.....|:||.|:..:..:||.|.|...|.::..| :.|.|..|:..
 Frog  1790 MKATAMVSAE-GEVMPFRQVVAAEGRVEDWMTTVLQEMRRTNRLITKEAIFRYCEDKSRVDWMLL 1853

  Fly  1785 WPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMT 1849
            :.....|.|.|:.||.|..|.|.||::..:.|||:|.||...|::.|:..:...|:..:|:|..|
 Frog  1854 YQGMVVLAGNQVWWTWEVEDVFRKVKKGEKQALKNYAKKMHQQIDELVTRITKPLSKNDRKKYNT 1918

  Fly  1850 ICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRL 1914
            :..||||:||:|...:...:.....|:|:||||..||.:.|:.....|...|.|.|||:|...||
 Frog  1919 VLIIDVHARDIVDIFVRDSIMDAREFEWESQLRFYWDREPDELNVRQCTGTFAYGYEYMGLNGRL 1983

  Fly  1915 VITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDI 1979
            ||||||||.|:||||:|.:.:|||||||||||||||||||.:|||::..|.||.|.||||::|.|
 Frog  1984 VITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKI 2048

  Fly  1980 HKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMN 2044
            ..||||.||||||||||||...||||::.|::.|::|:....:.|.|.|:.|||...:|:|||||
 Frog  2049 FSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHHLKRFQFEGQEIALDARMGIFITMN 2113

  Fly  2045 PGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQD 2109
            ||||||.||||::|||:||..::|||...|.||||.:|||.:|:.||:|...||.|.:|.||||.
 Frog  2114 PGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLQAKNLAKKMTVLYKLAREQLSKQH 2178

  Fly  2110 HYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDV 2174
            |||:||||:|||||:||.|:|......||.||||||||.|:||.|.:|||:|:|||.||||.||.
 Frog  2179 HYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDC 2243

  Fly  2175 PRKRNPEFEAVIKRSALDLKLQPEDGFIL------KIVQLEELFAVRHSVFIIGFAGTGKSEVWK 2233
            ||.|.|:|     ..|::..|| |:.:||      |:||:.|....||:..::|..|.|||.|..
 Frog  2244 PRVRYPDF-----NDAVEEALQ-ENNYILLPTQVDKVVQMYETMLTRHTTMVVGPTGGGKSVVIN 2302

  Fly  2234 TL----------NKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLG 2288
            ||          .|.|          .|||||::..||:||::|:||:|.||:.|.:.|:.    
 Frog  2303 TLCLAQTKLGLVTKLY----------TLNPKAMSVIELYGILDPATRDWTDGVLSNIFREI---- 2353

  Fly  2289 GTGP------KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATP 2347
             ..|      ::|:.|||:|.:|:|::|:||||||:||||:.|||.|.....||||:..|:.|:|
 Frog  2354 -NKPTEKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQPHCALLFEVGDLQYASP 2417

  Fly  2348 ATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIF---------RTR 2403
            |||||.|:::::|::|.:.|:.|.|:..|.:..|.|:|:.||:||||..:::.         ..:
 Frog  2418 ATVSRCGMVFVDPKNLKYMPYWQKWVNNRQSKQEQSVLSKLFEKYVPHCIEMIVEGITDGKQGEK 2482

  Fly  2404 LRSITPISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNE 2468
            |::|.|.:|:..:.....:||::|  :...:|.  |..|.||:..:.|..|::|.:...|.: :|
 Frog  2483 LKTIVPQTDLNMVTQLSTMLDALL--EKEVDDA--DVLECYFIEAMYWSLGATLLETGRIKF-DE 2542

  Fly  2469 FSKWFLNEYKAV-KFPLSG---------TIFSFYIDHETKKFFPWTNLVPQF-----ELDMDLPL 2518
            :.|...:...|. :..|:|         ||:.|:.|.|.||:.||:.|||::     |..:|:  
 Frog  2543 YIKRLASMSAAYDESILAGPGELPYQQPTIYDFHFDGEKKKWIPWSKLVPKYIHKPEEKFIDI-- 2605

  Fly  2519 QSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTT 2583
               ||.|.:|||..:.::.:::...|::|:|.||:.||......|..|.:|...:.::.|:..||
 Frog  2606 ---LVPTVDTTRTTWLLEQMVKIKRPVVLVGESGTSKTATTLNLLRNLNTDATMLLSINFSSRTT 2667

  Fly  2584 SEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQ 2648
            |..:||.||..:||:...||||...||::.|:||||||:||:|.|.||..|::..::....|||.
 Frog  2668 SMDIQRNLEANVEKRTKDNYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGGMYDRG 2732

  Fly  2649 K----MTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDN 2708
            |    ..|||:   ..:|.|..:.|... :|.|....|..|.|..||:::|..|.:|||..|   
 Frog  2733 KELNCKYLRDL---GFIAAMGKAGGGRNEVDTRFISLFSVFNVLFPSEESLSLIYSSILKGH--- 2791

  Fly  2709 PIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNS 2773
             ...|::.|..:|:.:....:.|:..:|....||..||||.|||||::.::.|::.:..|.....
 Frog  2792 -TALFNEEVQAICDKLTFCTLELYKMIVRDLPPTPSKFHYIFNLRDLSRVYNGLVLTTPERFQTV 2855

  Fly  2774 NQMIRLWIHECYRVYGDKLVDYTD----INSFKKIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKG 2834
            .||:|:|.:|..||:.|:||:..|    ....|.::.:..:..:|....|     |:::..:...
 Frog  2856 AQMVRVWRNENLRVFHDRLVNEEDKLVVQGHIKHLIEEHFQASLEHATRD-----PILFGDYRTA 2915

  Fly  2835 LTDIK---YMPISGWDRLKSLLDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLI 2896
            :::.:   |..|..::..|:|..|..:.||:....|||||||||:.|:.||.||:...||:|||:
 Frog  2916 MSEGEPRVYEDIQDYEAAKALFQEILEEYNESKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLV 2980

  Fly  2897 GVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAR 2961
            ||||||||||.|||::.:..:||:|.|::.|..:..:.::..||:|.|::.....||.||:.||.
 Frog  2981 GVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAE 3045

  Fly  2962 EQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLC 3026
            |.||.|:|::|.||.:..||||||.|::::.:|:|..:.|:...:|:.|::|:.|..:.|.:||.
 Frog  3046 EGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLG 3110

  Fly  3027 FSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVH 3091
            .||||.|||.|.|.||.|||.|.||||..||.|||.:|:..||.:.:::|.:.:.||:..:..||
 Frog  3111 MSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQALYAVANSFLGDNSLIPSQHSEPVTGHVVMVH 3175

  Fly  3092 KTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVD 3156
            .:|...||.:....:|.||.|||::|:.|..||:||.||.:.||.:..|||.||.||...|.::.
 Frog  3176 DSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRLLEEKNQYNLAQCKRLEGGLDKLKEATVQLA 3240

  Fly  3157 ALQDVLKVQEVELKIKNQEADNLIIVVGT------ENEKVSKERAFASKEEKNVRQIEEDVTAKA 3215
            .|...|..|:|.|..|:...:.|:..:.|      |..|:::|:|...:|:..|..:|:. .|::
 Frog  3241 ELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQ-EAES 3304

  Fly  3216 KLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSW 3280
            .|.|     |.|.|.||:..|..|:|:::||::||..||.||..||..:||:   :|.  |:.||
 Frog  3305 ALAE-----ALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVM---RGY--KEISW 3359

  Fly  3281 KACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININ 3345
            |:.:..|.: ..||.:|:..|...|....:||::.::.....:.|::.|.|.|..|:..:|..:.
 Frog  3360 KSAKGMMSD-PSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEAISKAGLGMLKFVEAVM 3423

  Fly  3346 RFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEA 3410
            .:.||...::||...:.:.|:....::..|..:...|:.::.:|.||..:|:.|:.:|||.|:||
 Frog  3424 GYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEA 3488

  Fly  3411 SKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQE 3475
            ......:..|::||.||.:|..||...::.|.....:|.||.|:.|.|:||.|.|...:|:|:..
 Frog  3489 EVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVY 3553

  Fly  3476 KLWMPAFKNSQPPIPSTDGVDPF---EMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLM 3537
            ..|.......:.|:.     .||   .::.||.:|:.|.::|||.|.:|.:|..:..::.|:||.
 Frog  3554 TEWQQDILAREIPLS-----QPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLC 3613

  Fly  3538 IDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLL---- 3597
            ||||.|.:.|:|.| ....|.:...:..::|.|:|.|:..|...|.:::.|.||||::.:|    
 Frog  3614 IDPQQQALNWIKRKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNI 3678

  Fly  3598 ----GRQLIKKGTVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQL 3658
                |||.|      .:||:|:|::..|:|.|:|||:||.|.|.:..:..:||:|||..||||||
 Frog  3679 KGAQGRQFI------ILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQL 3737

  Fly  3659 LAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTA 3723
            |:.:|..||.:||..|..|.|:.:..|..||.|||.||..|:::..|:|::|.||..||:||..|
 Frog  3738 LSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKA 3802

  Fly  3724 DEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLK 3788
            .|:..|:..|:.|.|.||..|:.|||||:|.:|::|:|:::..:|.:||:||.:|..||::::.|
 Frog  3803 TEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRK 3867

  Fly  3789 AMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFP 3853
            ::....|..|::|::|::|:..:.|...||||:.||:|...:.::|....|.|...||||.|:..
 Frog  3868 SLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGN 3932

  Fly  3854 YMPNQTSN---FTWLTHVGWGGIRALNN--QAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGE 3913
            ....::..   .:|:...||..|..|:.  .::|..|..|:|.....||.:.|.::.|...:|..
 Frog  3933 ISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLG 3997

  Fly  3914 WKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSP 3977
            :..| |..|:|.::||.|.||:..|:..::...:|.||:....:.|...||:|.|.:.|.|:|||
 Frog  3998 YNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFEQSVPTSPIVFILSP 4062

  Fly  3978 GVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPS 4042
            |.||..|:.||.:..||..:...|  :::|||||.||...:|.|...|.|::|||.||:.:||..
 Frog  4063 GSDPASDLMKLAERSGFGGNRLKF--LAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKD 4125

  Fly  4043 LEKKMESSLSNVHTSYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSD 4107
            |||.:| .:...|..:||:|:.:|..:     .|.|||:.::|:..|||.|:..|:.......|.
 Frog  4126 LEKALE-MIKKPHPDFRLWLTTDPTKE-----FPIGILQKSLKVVTEPPNGLKLNMRATYFKISH 4184

  Fly  4108 ETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL-----E 4167
            |.|:.| :.:.||::::.|.:|||||.||||||..|||..|.||..|..:.:.:|..||     :
 Frog  4185 EALDSC-QHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQ 4248

  Fly  4168 ANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELID----------GELEYCQGF 4222
            .:|::||..|:||.||:||||...|.:|||:..||::|::...:.|          .|::|    
 Frog  4249 HDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDY---- 4309

  Fly  4223 PAPGILKYTGYHNYID--DNLP-SESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSG 4284
               .|.:.|....:::  ::|| :.:|.::|||||||||:.|..:..::..:.||||: ||.||.
 Frog  4310 ---RIPEGTTKDAFVEAIESLPLANTPEVFGLHSNAEIGYYTQAARDMWTHLLELQPQ-TGESST 4370

  Fly  4285 GETVSQEDIIKNIIEDILDKTPTPFNILELMGRVE-DRSPYIIVAFQECERMNNLMTELKRSLNE 4348
            |  :|:::.|..:.:||.:|.|..|::.::...:. :.||..:|..||.||.|.|:..:.|||.|
 Frog  4371 G--ISRDEYIGQVAKDIENKLPQIFDLDQIRKNLGLEISPTTVVLLQELERFNKLIIRMSRSLVE 4433

  Fly  4349 LDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRM 4413
            |...|.||:.:||.::::...|:..|:|..|.:||..::..|.:|......|..:...||.:.. 
 Frog  4434 LQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESE- 4497

  Fly  4414 PSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTK-KWKEELTTAPREGAYINGLFME 4477
            |:.:||:|...|:|.|||::|.|.|||.|||||..|...||. :..||:|..|.:|.:|:||::|
 Frog  4498 PNVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSFRTPEEVTERPGQGCFISGLYLE 4562

  Fly  4478 GARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLR----GPTFVWTFN 4538
            ||.||:....:..:..|.|...:|||.:..:...:..::|.:..|||...:|    |...|:..:
 Frog  4563 GADWDIANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEAD 4627

  Fly  4539 LKSRERASKWTLAGVCLLLQT 4559
            |.:.:..|.|.|.||||.|.:
 Frog  4628 LYTTKHNSHWVLQGVCLTLNS 4648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 127/622 (20%)
DHC_N2 1368..1770 CDD:285579 137/413 (33%)
P-loop_NTPase 1903..2132 CDD:304359 142/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 61/151 (40%)
P-loop_NTPase 2510..2783 CDD:304359 93/283 (33%)
P-loop_NTPase 2860..3127 CDD:304359 120/267 (45%)
MT 3140..3480 CDD:289543 105/346 (30%)
AAA_9 3509..3722 CDD:289547 87/222 (39%)
Dynein_heavy 3864..4549 CDD:281078 244/712 (34%)
dnah10XP_012824530.1 CCDC168_N <37..>138 CDD:292432 8/38 (21%)
DHC_N1 348..935 CDD:285571 129/649 (20%)
DHC_N2 1434..1838 CDD:285579 138/416 (33%)
P-loop_NTPase 1972..2202 CDD:304359 142/230 (62%)
P-loop_NTPase 2288..2423 CDD:304359 62/150 (41%)
P-loop_NTPase 2598..2865 CDD:304359 93/279 (33%)
P-loop_NTPase 2944..3211 CDD:304359 120/267 (45%)
MT 3223..3556 CDD:289543 104/345 (30%)
AAA_9 3585..3801 CDD:289547 87/222 (39%)
Dynein_heavy 3942..4638 CDD:281078 244/716 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.