DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah5

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_012820905.1 Gene:dnah5 XenbaseID:XB-GENE-854543 Length:4679 Species:Xenopus tropicalis

Alignment Length:4905 Identity:1416/4906 (29%)
Similarity:2374/4906 (48%) Gaps:647/4906 (13%)


  Fly     1 MADEKE-KKEPVDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIE---------FLNNPNK 55
            :.:||| |:..:|.|.::....:...:.|:         .:|..|.|:|         |......
 Frog    69 LKEEKEAKRAQLDGRHDYVLGIVAACLNLE---------KSEVEDAILEGNQIERIDRFFAVGGL 124

  Fly    56 KRIIFTIN-----SGGQL--YPSYSFPVRPRYK-----------VA------YFIRYLTPLHLTD 96
            :.|:|...     ..|.|  :.:.:..:..|.|           ||      :|||..:...:|.
 Frog   125 RHIMFYYQDVEAAEAGHLGSFGAVTSTLVARNKKPKVFLTEGKDVALTGVCIFFIRSSSTKPVTM 189

  Fly    97 E--------NML----NSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVIANDMKTES 149
            |        |||    |||         |.::..|..:::.|.|....|  ||..::  |.:...
 Frog   190 ENVHREVHFNMLDTSGNSL---------LGSVESLLSDIYIPALKTMDN--GWGELV--DPQQAG 241

  Fly   150 QEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVN------PLMKHSLEFMVVKW 208
            ...::.:..::|.|             .|:..|....|..:::..      ..:|...:::.|  
 Frog   242 NVKQDFLGSLEGFV-------------GVLSGAQQSLMDKVNLKKCETYDLRTLKGPCDYLTV-- 291

  Fly   209 LDSVEDLVNIKAGEKIYSK-------ENFPL--------PEAIFSFWESRLENLENLAEQLGDRR 258
            .:|.|.|..|:.|.|::.|       |:..|        |.|....|:.||.....|.:||....
 Frog   292 ANSSEGLERIEEGMKVWIKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPE 356

  Fly   259 IKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDMDENRSDIRPL 323
            :|.:..||...:|.....:|.:...:.:|..||:|..|.|..|::..|....:|.......|..|
 Frog   357 VKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRL 421

  Fly   324 MLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCV------NRTVEPDSIFQGDVDEAYKKLDIN 382
            |..||::...|||::|...:|..|....|.:|...      |:|.:   |:....|...:||...
 Frog   422 MNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAK---IWDQAQDVVVEKLKSA 483

  Fly   383 MQHLEYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQK 447
            ::..|:|:..:::.:.:.::......|:     :.:..|||:.|.|..|||::..:|.|:..:..
 Frog   484 IKLNEFYQHAFHKTKETREQIPTERQFD-----FSEVYIFGKFDTFQRRLEKIIHIFETITTYSS 543

  Fly   448 LEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKT-DVME 511
            |:...:.|         ||.:..::.|........||:.:  |...:.|..|...|..:| |:..
 Frog   544 LQNSKIEG---------LEMVTTKFQSTVATIKKKQYDFL--DQRRTEFDDDYEEFVKQTHDLHT 597

  Fly   512 RMVSFQ---FEKGLEDTHDLLLAGSLLLRPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVF 573
            ::.:|.   ||:.......:::........|....:|.....|:.::..:|..|.|.:...|   
 Frog   598 QLKTFMDSTFERNYNTERSIIMLEKFERLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQK--- 659

  Fly   574 TALGLNELPTDDCFPKVSGAISFLKKLRHRI---IGLHKEHELYEYPLFDNERGGYVSDIFNIMV 635
                 ||.|.....|.|:|.|.:.::|.|||   :.|.::|.    .....|....:...:|.:.
 Frog   660 -----NEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQQHS----TALQTEEARRIIRNYNKVA 715

  Fly   636 QEIDDFTKMLLDKWTVE---CWQGIQQDITLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGC 697
            :.:.::..:....|..:   ...|:...:   |::..|..||.|||...::..:::.:.:..||.
 Frog   716 KVLLEYEILFHRSWLKQMEVAKSGLHASL---LVKSPETLELFVNFDPLILTLIRETECMAKLGL 777

  Fly   698 DV---------SVNLTK-------FFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEM 746
            ::         ..|:.|       |...||:    |:|            .:.|...::|||..:
 Frog   778 EIPPFAATLQQKQNVYKKNFDNLQFMLMEDK----RIK------------SKVHAPLEQLIAPHI 826

  Fly   747 ILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQ--- 808
            ..|:|.::|.|..:.|.:.:         :.|||.: :.....:||.:.:.:..   :.:|:   
 Frog   827 AKIDEAIQPGLLSLNWTSLN---------IEKYLKN-IAEKHADLELLLDRVND---LVVFRIDA 878

  Fly   809 -RKDLNPALLLHTDPREPI-----------------LSIRAANAADTQRLIDLLMYVNLKLFFDI 855
             .:|::...|......||:                 ::::|.:....:...:|   :|:.|..||
 Frog   879 VLQDMSITPLCKLPEEEPVSCEQFLQMTKDLCAKGAVTLQAKSCMVEEAANEL---INMLLDLDI 940

  Fly   856 PRRYSLPPGEHGEED----------EESDG----------------------IWPPIISLSVMTS 888
                     ..|:||          |:|:.                      |.||        |
 Frog   941 ---------HSGDEDAKSFVGHRIMEDSNDISGVSLQRSQTVSSTHVVSQATIGPP--------S 988

  Fly   889 VKFKKKREVIDEEDDLEEFEEEQSESEEEIITPF-HRY--ELLKGLSQEERALFREYEIYVDEII 950
            ...|||:     :|.:|..|||..    |:::.| ||.  .|||                    :
 Frog   989 PPTKKKK-----KDMMEILEEEAC----ELLSHFNHRNVDALLK--------------------V 1024

  Fly   951 AENLVDSV---ITSSTYLRM----EVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFF 1008
            ..|.::::   |..|:.:..    .:..:..|..|||:..:.|..||::....||...       
 Frog  1025 TRNTLETIRKRIQMSSMISFLDGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQ------- 1082

  Fly  1009 IETILDDMNNMMSLLKRVAQ------------------------------------------DPT 1031
             :|:...:.|::::.|.|.|                                          :.:
 Frog  1083 -QTLNKAVENIVNVSKGVGQWSKERMSKKNILERKITAMRGNSNDSDSEDVIVEAGGRSTHENIS 1146

  Fly  1032 EVTNMNPYSF------YDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTY 1090
            ||.:::..:|      :..:.:..|:.|....:...|....:.|....:.|..:..:|..|:.  
 Frog  1147 EVASISTVAFVHNKNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRD-- 1209

  Fly  1091 LSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFF 1155
             :.::||              :.||          |.||.::.|:..|.:|:..|.|...|....
 Frog  1210 -NVIEKF--------------VSGS----------PLLSEFESQILHFRDLELAINTEPEYICVG 1249

  Fly  1156 VFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVK 1220
            : :.|.....|:|:.|:...|:.........:.::.::.:..|::|.|  .|:..|..|.:.:..
 Frog  1250 I-IALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEIN--KKLNRQIKDLDDIRI 1311

  Fly  1221 ILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKV--------KRL 1277
            .::.|.:|.|.|...|....|::|...:|.:|.......|..:::.|...|.|:        ..|
 Frog  1312 AMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNEL 1376

  Fly  1278 AATTK----QLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYEL-------- 1330
            .|...    :||:.:|::..|..|                      |:    |.||:        
 Frog  1377 MAIQPNFRGELISTVQTFIQDCSE----------------------FY----SDYEMNGPMIVGL 1415

  Fly  1331 -IDESDLELVALEERQRSLAESAV-------LFELQGPD-PVKIELCRFDLKLVKIMWDFAITIQ 1386
             ..|:...|:..:.|..:|....:       ||.||... |..:|: :..|.|::.::.....:.
 Frog  1416 APQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEI-KKQLNLLQKLYGLYNNVI 1479

  Fly  1387 STINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQN 1451
            ..:|.:....|..::||.::.|..:|....|.|.:|::.|:.|:.::.::.:.......:..:.|
 Frog  1480 EIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSN 1544

  Fly  1452 PAIRDRHWIELMQTTKVKFSMDDST-TLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIAT 1515
            .|:..|||..:...|...|.:::.| .|:::::..|.:.:||:::|...:|||..:|::|:.:..
 Frog  1545 KAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIA 1609

  Fly  1516 AWGTMEFGTDIHDRTSIKLL---KASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSN 1577
            .|....| |..:.:|..:||   .::.|:|.::||....|.::.|::|...|:.:::.|.:.|||
 Frog  1610 EWDNKTF-TFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSN 1673

  Fly  1578 ADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRST-- 1640
            ...||.||..||..|.|||::|:|. ||..|||::::||..|||.:..::.:.:...|||:..  
 Frog  1674 TTDIIESWMTVQNLWIYLEAVFVGG-DIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVG 1737

  Fly  1641 NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLT 1705
            :.:..:|..|   ||:.|.:|:|:|..|||.|||.:|||:|||...||:||...::...:..||.
 Frog  1738 DETMGQLLPH---LLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLL 1799

  Fly  1706 KLYDSMGKL--------NLISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTL 1762
            .::|::..:        .::|.|......:  |||::|.      ..|.||||||.:..:.:.:|
 Frog  1800 NVFDNIKSVRFHEKVYDRILSISSREGETI--ELEKHVM------AEGNVEVWLNSLLKESQSSL 1856

  Fly  1763 RDQLKR-SLTFYDHKPRHV-WIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQ 1824
            ...::: ::...|...:.: ::..:|||..|:|.|::||.:..||....  :|: ..::..|:..
 Frog  1857 HLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNA--KYDKKIMQKTNQSF 1919

  Fly  1825 ITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKI 1889
            :..||.||.:...||::.||.|..|:.||.||.||:...:....::..|.|:|..|.|..::...
 Frog  1920 LDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDS 1984

  Fly  1890 DDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDL 1954
            |..|.||.|..|.|..|:||.|.|||||||||||||||.|:|.:.|||||||||||||||||||:
 Frog  1985 DKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDM 2049

  Fly  1955 GRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKS 2019
            ||.||..|.|||||:|||::.:|.|.|||||:|:||||||||||.:.||||.|.|:..:....|.
 Frog  2050 GRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKE 2114

  Fly  2020 KKQTFSFL-GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEG 2083
            :|:.|.|. |:::.:....|:|:|||||||||.|||||||..:|..||:|||..:|..:.|.:.|
 Frog  2115 RKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCG 2179

  Fly  2084 FQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDF 2148
            |.:..:|||||.|||.||:|.||||.|||:|||.|.|||...||.:|.:....|..::||.|||.
 Frog  2180 FIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDM 2244

  Fly  2149 NIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFA 2213
            |:.|::.:|.|:|:.||.||||::.:.:...||.||.|.:......|.....:.||::||.|...
 Frog  2245 NLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQR 2309

  Fly  2214 VRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYN-DLNPKAVTNDELFGIVNPSTREWKDGLF 2277
            |||.:..:|.:|.||:....||.|. .....:||.. .:||||:|..::||.::.:|.:|.||:|
 Frog  2310 VRHGMMTLGPSGAGKTTCIHTLMKA-MTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIF 2373

  Fly  2278 SILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASL 2342
            |.|.|...........||||||.:|.:|||:||:|:||||.||||:.:||.:....:::||..::
 Frog  2374 STLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNI 2438

  Fly  2343 RTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSI 2407
            ..|:||||||.|:::::...|.|:|.::.||..|:...    .|:|...|.....:::|..::|:
 Frog  2439 DNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQD----ANILRKLYSASFAELYRFSVQSL 2499

  Fly  2408 TPISDIAR---LQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEF 2469
            ....::..   :..:..:|..::..::...:...:..|..:||.::|..|:.|..|..|    :.
 Frog  2500 EYKMEMVEAFIIMQSINMLQGLIPSKDQGGEISAEHLERLYVFSLMWSIGAMLELDDRI----KM 2560

  Fly  2470 SKWFLNEYKAVKFPL-------SGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQ--SNLVNT 2525
            .:| |....:|...|       ..|:|.:|:..| .|:..|...|.::....|...:  |.||..
 Frog  2561 EQW-LRSLDSVHLDLPKIPPGSDDTMFDYYVTTE-GKWMHWNTSVEEYVYPSDSTPEYGSILVPN 2623

  Fly  2526 AETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRI 2590
            .:..|..|.:.|:.:....::|||..|:.||:::...:|....::|....:.|:..||..|.||.
 Frog  2624 VDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRT 2688

  Fly  2591 LEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK----MT 2651
            :|..::|:.|..|||...|:|..|:||:|||.::::.....:.::||.|:.:.:|:.:|    ..
 Frog  2689 IESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTN 2753

  Fly  2652 LRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNP---IQKF 2713
            :.|:.  .:.|.::|..|...|..||:|.|..|....||..::..|...|...|..:.   :...
 Frog  2754 IIDVQ--FLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDI 2816

  Fly  2714 DKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIR 2778
            .:||.||    :.....|.....|..|||..||||.|||||::.|:.|:|.|.||...::..:|:
 Frog  2817 KEAVKKL----IPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIK 2877

  Fly  2779 LWIHECYRVYGDKLVDYTDINSFK----KIVSDIVRKGIEGVNDDVVYAQPLIYCHFAKGLTDIK 2839
            ||.|||.||..|:.....|::.|.    |:|.|...:|.:..:..|.|       :|...|.|..
 Frog  2878 LWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDY-------YFVDFLRDAP 2935

  Fly  2840 -----------------YMPISGWDRLKSLLDEAQDRYNDYI-GA-MNLVLFDDAMSHVCRISRI 2885
                             |.||..:::||..|:.....:|:.| || |::|.|.|||.|:.:||||
 Frog  2936 EATGEEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRI 3000

  Fly  2886 LESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSAC 2950
            :.:.||.|||:|||||||||||:|||:|:....|||.|::.|:.|:|..::..||..||.:....
 Frog  3001 IRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGI 3065

  Fly  2951 CFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENI----VNAVRNEVKQLGIVDNRENCWK 3011
            .|:.||:|:..|.||..:|::|:||::..||..||::.|    :..::.|..:.  ....||.::
 Frog  3066 SFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRR--PPTNENLYE 3128

  Fly  3012 YFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITV-- 3074
            ||:.:||..|.|||||||||...|.|:.|||||::..|:|||..||:.||.:||..|||...:  
 Frog  3129 YFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDC 3193

  Fly  3075 ---LPKELALPVSNFM-AFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEK----- 3130
               :.||:...:.:|. ....|.|.     |....:|..:.||||:|..|..|..:..||     
 Frog  3194 TPEIKKEVVECMGSFQDGVAEKCVE-----YFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQ 3253

  Fly  3131 VKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERA 3195
            ..||     |:..||.||...::.|.||...|:|:|.||:|.||:||.::..|..:.:...|.:|
 Frog  3254 TLAN-----RMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKA 3313

  Fly  3196 FASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSV 3260
            ...|.:...:.|.::::|...:.||....|:|||..|:.||.|:...::..:::.|.||..::.:
 Frog  3314 EVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRI 3378

  Fly  3261 CGAVLVLFSSK---GKIPKDR-----SW-KACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPY 3316
            ...||:||..|   .|:.:::     || ::.:..:||   ||.||..:.|..|:.:|::.||||
 Frog  3379 MDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN---FLQNLQQFPKDTINEEVVELLQPY 3440

  Fly  3317 ILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLR 3381
            ....:::.|.........||||||...:..||.:...|.|.:..|...|..:..|...|......
 Frog  3441 FEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAE 3505

  Fly  3382 LTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQ 3446
            |...:.:|:.:|.||::|:.:||...::|.:....:..|:.||.|||.||.||.|..|......:
 Frog  3506 LDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTK 3570

  Fly  3447 QLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWN 3511
            :|.||:|:.:.|:||.|.|.:.:|..:... |....|..:  ||....::..||:.|...|:|||
 Frog  3571 RLVGDVLLATAFLSYSGPFNQEFRNFVLTD-WRREMKARK--IPFGVNLNLNEMLIDTPTISEWN 3632

  Fly  3512 NQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVS 3575
            .||||:|.:|.:|..|:.::.||||:||||.||..|:|.| ....|.:..|:.:.:.:.:|.::|
 Frog  3633 LQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLS 3697

  Fly  3576 NGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRLILHTKLANPHYKPEM 3638
            .|..||||::||.:||.|:.:|.:..||.|:.  :|:||:|:|..:.|||.:.|||.||.|.||:
 Frog  3698 LGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEI 3762

  Fly  3639 QAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAG 3703
            .|:|::|:||||..|||||||..|:..|:.:||..||.|.:.....|..:|.|||:||.||:|..
 Frog  3763 SARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQ 3827

  Fly  3704 DNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKIN 3768
            .:::||.:|:..|..|||||:|:..|:..:..|.:||:||||.|||.|.|.||:||::.::..:|
 Frog  3828 GSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVN 3892

  Fly  3769 PIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQ 3833
            .:||.||:.|..:|:.::.::..:.....|:.|:|:.:|:..:.|.:|||:|:.|.:|...|.::
 Frog  3893 VMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLK 3957

  Fly  3834 ILVNLGEVEPTELDFLLR---------FPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDI 3889
            |.:....|:..|...|::         .|..|::     |:..:.|..:..|:....|..:.:.|
 Frog  3958 IDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSK-----WILDMTWLNLVELSKLRQFSDILEQI 4017

  Fly  3890 EGSHKRWKKFVDSESPENEKFP-GEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDA 3953
            ..:.|.||.:.|.|.||.|..| |..:.....:||.::|...|||.....|.:|.:.:||||::.
 Frog  4018 ARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEG 4082

  Fly  3954 RSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAI 4018
            ..::..:|:|||:|.|.:...||.|.||...:..|||.......:     ||:||||||.|...:
 Frog  4083 VVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRY-----VSMGQGQEIHARKLL 4142

  Fly  4019 EIASQYGHWVILQNIHLVARWLPSLEKKMES--SLSNVHTSYRLFLSAEPAGDPAAHILPQGILE 4081
            :.....|.|.:|||.||   .|..|::.|::  ...|:|.|:||:::.|     .....|..:|:
 Frog  4143 QQTMANGGWALLQNCHL---GLDFLDELMDTIVETDNIHESFRLWMTTE-----VHRQFPITLLQ 4199

  Fly  4082 SAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNR 4146
            .:||.|||||.|:.|.:.:.....|.:.|:: :..|::|.:|:::.:.|:.|.|||||||.|||.
 Frog  4200 MSIKFTNEPPQGLKAGLKRTYGGVSQDLLDV-NNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNI 4263

  Fly  4147 SYPFNVGDLTISVYVLYNYL---EANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQ 4208
            .|.||..|...:|..:.|:|   :....|.|..:||:.|||.|||.:|||:|:||..|:.:.:..
 Frog  4264 PYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFS 4328

  Fly  4209 PELIDGELEYCQGFPAPGILKYTGYHNYIDDNLPS-ESPSLYGLHSNAEIGFLTTVSERLFRIVF 4272
            ..:...|..:.:|:..|.......|..|| ..||: ::|.::|||.||:|.:.:.:::.:...:.
 Frog  4329 ETMFTQEFCFYKGYNIPKCNTVDHYLQYI-QGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTIL 4392

  Fly  4273 ELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPT---PFNILELMGRVEDRSPYIIVAFQECER 4334
            .:||:.:.| .||||  :|.::..:.:|:|.|.|.   ||.:.|.:.::....|..|...||.:|
 Frog  4393 SIQPKDSSG-GGGET--REAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDR 4454

  Fly  4335 MNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAY-PSMLGLQSWFSDLM 4398
            |..:::.::.:|.:|.|.:.|.:.:|..:.|.:.|:|..::||:|.|.:: .|.||.  ||::|:
 Frog  4455 MQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGF--WFTELL 4517

  Fly  4399 LRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNE-WPLDRMCLNCDVTKKWKEELT 4462
            .|.::...|:.:.| |:..|:.||||||..|||:.|:..|.|: |.||.:.:..:|||..|:::|
 Frog  4518 ERNKQFSSWIFESR-PNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDIT 4581

  Fly  4463 TAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIR 4527
            ....||.|:.||:::||.||.:...:.::..|.||..|||:.|.|.....:| ...|.||:||..
 Frog  4582 APASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTSTKD-NRFYSCPIYKKP 4645

  Fly  4528 LRGP-TFVWTFNLKSRERASKWTLAGVCLL 4556
            :|.. .::...:||:.:....|.|.||.||
 Frog  4646 VRTDLNYIAAVDLKTVQSPDHWILRGVALL 4675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 130/613 (21%)
DHC_N2 1368..1770 CDD:285579 115/417 (28%)
P-loop_NTPase 1903..2132 CDD:304359 139/230 (60%)
P-loop_NTPase 2217..2352 CDD:304359 55/136 (40%)
P-loop_NTPase 2510..2783 CDD:304359 83/282 (29%)
P-loop_NTPase 2860..3127 CDD:304359 113/279 (41%)
MT 3140..3480 CDD:289543 105/349 (30%)
AAA_9 3509..3722 CDD:289547 96/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 224/698 (32%)
dnah5XP_012820905.1 DHC_N1 298..850 CDD:285571 127/611 (21%)
DHC_N2 1461..1863 CDD:285579 115/416 (28%)
P-loop_NTPase 1998..2229 CDD:304359 139/231 (60%)
P-loop_NTPase 2313..2448 CDD:304359 55/136 (40%)
P-loop_NTPase 2618..2882 CDD:304359 82/270 (30%)
P-loop_NTPase 2980..3244 CDD:304359 110/271 (41%)
MT 3258..3595 CDD:289543 104/340 (31%)
V-ATPase_G_2 3262..3359 CDD:293604 33/97 (34%)
AAA_9 3630..3846 CDD:289547 96/216 (44%)
Dynein_heavy 3988..4668 CDD:281078 225/707 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.