DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah3

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_012826767.1 Gene:dnah3 XenbaseID:XB-GENE-854566 Length:4068 Species:Xenopus tropicalis

Alignment Length:4089 Identity:1310/4090 (32%)
Similarity:2050/4090 (50%) Gaps:479/4090 (12%)


  Fly   732 ERAHPTEKRL----------IAAEMILIE--EQMKPLL----DFIKWNAFSQRFIVMIFKMVKYL 780
            :.|||:|:.|          |..||:..:  |||..:|    :::..|...::.||.|.:.::| 
 Frog   194 KEAHPSERDLERYFFYIHHGIQKEMLAPQETEQMDRILTSVPNYLLNNPSLEKIIVKIKEEIEY- 257

  Fly   781 HDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPRE-PILSIRAANAADTQRLIDLL 844
                    :...:::::|..:    :.:..:....|.:...|.. |:..|||             
 Frog   258 --------DYYTSLRKTIVDY----ILKDPEEKERLFIANTPHPFPLRVIRA------------- 297

  Fly   845 MYVNLKLFFDIPRRYSLPPGE-HGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFE 908
                       |..:.:...| ||...:....:.|.::||..:.          |::.|||....
 Frog   298 -----------PVPWHISYNEAHGWNQDHLFTVNPMVLSLQELW----------INQFDDLRFVR 341

  Fly   909 EEQSES--------EEEIITPFHRYELLKGL-------------SQEERAL-------------F 939
            .|:..|        |.|.:...|..|....|             ||:::.:             .
 Frog   342 TEELLSGCLPLLPAEFEEVVQRHCREAHTALRNKWIPACASLFTSQKDKWIHLVPQHDNDSTLQV 406

  Fly   940 REYEIYVDEIIAENLVDSVITS------------------STYLRMEVDNRYENNTP-IFEIFME 985
            :|:...:..:::..|...||.|                  .||..|:.      .|| |..:.:.
 Frog   407 QEFFACIASLMSLQLRGMVINSLQDLLSFFTLHQNGNDFGDTYEEMKF------CTPQILIVKLR 465

  Fly   986 LQEPNVVYFRNLD-------------TSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMN 1037
            ::||.:.:...|:             ..|..|.......:..|:......|..|.||.:.|:|  
 Frog   466 VEEPKIAFEPALEECWALIKCCFLEILKSAEGLPKVEVDLFPDLQTENLTLSSVTQDESLVSN-- 528

  Fly  1038 PYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLT 1102
                                .:||.              ||..:|.|.....||:..||:.   .
 Frog   529 --------------------YINKT--------------MEVFNLNIVGPQKYLNVYKKYS---D 556

  Fly  1103 LDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVF----LRLNMT 1163
            |..:.|:.|:  ||.:|    |...|..:.::::...:|:.:|.:........:|    ||||. 
 Frog   557 LLNQKAQQDI--SSFLK----EEHSLHAFTKKINSISQLRGEIASMHITVPLALFCLDALRLNE- 614

  Fly  1164 GFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQI 1228
                               ||..|.:....:|..||.:.|.||...:       ..|...:.:::
 Frog   615 -------------------DLCARAQTLKDQLIQFVVDENRVLNKSI-------CSKYSLIADKV 653

  Fly  1229 NEKQCIYDSMFDPLKEIIDLLRQYN----YEFKDTELAQINE--------LPDAWMKVKRLAATT 1281
            ||    ..|..:.|..:||.||:..    |:.||    :|:|        |..|.::...|...:
 Frog   654 NE----VPSTTEELVALIDFLRKSRDVTVYKLKD----EISEAASRLAFLLDYATLQYDDLKLNS 710

  Fly  1282 KQLIAPIQSYQV-DLIEKRILLCDNMA----NTYRKKFLSKKFFFVPCLSCYE-----LIDESDL 1336
            .....|.|...| ::...|::...:.|    |..|.:|..|...:|..:..::     .:||...
 Frog   711 TVFYWPEQIETVFEVNNNRLMAKKDQAEDDLNKRRSEFEKKLQGYVTEIEAFKKRENMTLDEMKA 775

  Fly  1337 ELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKI----------MWDFAITIQSTIND 1391
            .:..|.|..|:|..:...||....:...:|..:....|::.          :|..|........:
 Frog   776 NVEKLNELDRNLNAALAEFEAINVEEELLEWEKSQFPLLQTAMLNKVPFEQLWITAYNFHCKSEE 840

  Fly  1392 WKKTPWKKIDIENMDQECKKFGRELRGLDKAM-------RTWEPFIFMEASLKNLMTSLRAVTEL 1449
            |....::.::.|::.:|.....|.:..|.|..       |..|.   |:..:......|..::.:
 Frog   841 WMNGAFQDLNAEDITEEVGNMWRNMYKLSKTFADMAGPKRVAEN---MKIKIDKFKMHLPIISVI 902

  Fly  1450 QNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIA 1514
            .|..|:.|||.::........:....|:|.::::..|.:|.|.::.|...:.||.::||.|..:.
 Frog   903 CNRGIKKRHWEQISDVVGYDITPAPDTSLLNMLEYGLSKYIERLEQIGASASKEYSLEKALEKMK 967

  Fly  1515 TAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNAD 1579
            :.|..:.|....:..||..:|.|.:::...|:||..:.|.|..|.:|...|.|.|.|:..|....
 Frog   968 SEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQ 1032

  Fly  1580 QIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSG 1644
            :|:.:|.:.|..|.|||.|| .||||.:|:||:.|:|..:|..:|.::.:...|..|:.:|.:..
 Frog  1033 EIMDAWLKCQATWLYLEPIF-SSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVKDTRVLIATKQDN 1096

  Fly  1645 --SKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKL 1707
              .:|.|. .:||:.:   :|.||.|||.|||.:|||:|:|:.:||:|||...:|..|..||.|.
 Frog  1097 MLGRLQES-NVLLEDI---QKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKC 1157

  Fly  1708 YDSMGKLNLISGSKNAAGMVAKELEEYVPFLEN---CDCSGKVEVWLNRITDKMRDTLRDQLKRS 1769
            ::.:.||. .:......||::.| .|.||..:.   ....|.||.||.::.:.|..::|..::..
 Frog  1158 FEGIAKLE-FTEDLQITGMISSE-NEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDG 1220

  Fly  1770 LTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIIL 1834
            :..|...||..|:.:||.|..:..:.|.||.|.::|.|      |..|..:.:|...|:..::.|
 Frog  1221 IDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIA------EGTLPAFLEKSNQQIGEIVEL 1279

  Fly  1835 LLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDA 1899
            :.|.|::..|..:..:..||||:||||..:...||...:.|||.||||:.|:.:  |....:...
 Frog  1280 VRGKLSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSWEGQ--DVMVKMITT 1342

  Fly  1900 QFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYV 1964
            :.:|.||||||:|||||||||||||.||..:|.|.:||||.||||||||||||||.:||.....|
 Frog  1343 EVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVV 1407

  Fly  1965 FNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGE 2029
            ||||:.:|||::|...|||||:|||.||||||||.||||||||.|:..||.||....:||.|.|.
 Frog  1408 FNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGT 1472

  Fly  2030 HIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKF 2094
            .:.|..|..||||||||||||||||:|||||:|..||:|||:|||.||.|.:.||.::|.||:|.
 Frog  1473 ELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKI 1537

  Fly  2095 ITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVP 2159
            :..|.||.|.||.|.|||:|:||:||||..||.|:....:..|..:|:|||.|.|:.|.:..|||
 Frog  1538 VATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVP 1602

  Fly  2160 VFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFA 2224
            :|.|:|.||||.:.:|:.....|...:|.:...|||||...||.||:|:.|:..|||...|:|..
 Frog  1603 LFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDP 1667

  Fly  2225 GTGKSEVWKTLNKTYQNQKRKPHYND-------LNPKAVTNDELFGIVNPSTREWKDGLFSILMR 2282
            ..||:..:|.|:....:.......::       :||||:|..:|:|..:|.:.||.||:.:...|
 Frog  1668 MGGKTCAYKVLSGALDDLHAANSMDEYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFR 1732

  Fly  2283 DQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATP 2347
            :||:......|||:.||.:|.:|||::|||:||||.|.|.|.|.|.::.:|.|:||.|.|..|:|
 Frog  1733 EQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASP 1797

  Fly  2348 ATVSRAGILYINPQDLGWTPFIQSWLGT---RTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSI-- 2407
            |||||.|::|:.|..|||.|...|::.|   ...|....|::.:|:..:.|.||..|:..:.:  
 Frog  1798 ATVSRCGMIYMEPHQLGWKPLQDSYMNTLPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVF 1862

  Fly  2408 -TPISDIARLQMTCY--LLDSMLTPQNVPNDCPKD------WYEIYFVFCIVWGFGSSLFQDQII 2463
             :|| .:|...|..|  |||.::......|: |..      |.:..|:|.:||..|.::..|.  
 Frog  1863 TSPI-HLAYSMMRLYTCLLDEIVNSSEEGNE-PMSSQQITLWLQGLFLFSVVWTIGGTINTDS-- 1923

  Fly  2464 DWSNEFSKWF------LNEY----KAVK------FPLSGTIFSFYIDHETK-KFFPWTNLVPQFE 2511
              ..:|..::      |:|:    |:||      ||..|:::.||...:.. ::..||:.:.:.|
 Frog  1924 --RKKFDIFYRNLLMGLDEHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKEE 1986

  Fly  2512 L---------DMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALP 2567
            |         |:.:|       |.||.|..||:.|.:|...|::.:||:|:||:.:.|:.|..||
 Frog  1987 LIIPTTAKVSDLIIP-------TMETARQTFFLKTYLEHSVPMLFVGPTGTGKSAITNSFLIKLP 2044

  Fly  2568 SDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPH 2632
            .:||...::.|:..|::...|.|:...|:::....:||...|:.:.||||:|||..:.|....|.
 Frog  2045 KNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPI 2109

  Fly  2633 TLIRQFMDYHHWYDRQKMTLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFH 2696
            .|:||::|:.|||||:..:..||.....|:.|.|..|... |..|..||.....::....:.|..
 Frog  2110 ELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTK 2174

  Fly  2697 ILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTG 2761
            |..||...|..   :.||.|.::..:.|:...:.::...|.:||||..|.||.|||||.:.:..|
 Frog  2175 IFGSIADWHFS---KGFDIAFLRTGKLMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRG 2236

  Fly  2762 VLYSNSETCP-----NSNQMIRLWIHECYRVYGDKLVDYTD----INSFKKIVSDIVRKGIEG-- 2815
            ||     .||     :|:::|||||||.|||:.|:|:|..|    .|..|:..|:..::.::.  
 Frog  2237 VL-----LCPHTHLQDSDKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKAL 2296

  Fly  2816 ---------VNDDVVYAQPLIYCHFAKGLTDIK-YMPISGWDRLKSLLDEAQDRYNDYIGA-MNL 2869
                     |:|::   :.|.:..:.|..:|.| |..|:....|.|:::...:.||:...| |:|
 Frog  2297 SHLAPTGKVVDDNI---RSLFFGDYFKPDSDTKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSL 2358

  Fly  2870 VLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKA 2934
            |:|..|:.|:.||.|:|:...|:.||:|:||||:||.|:||:|::|.::|||::||:|::|:.:.
 Frog  2359 VMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRD 2423

  Fly  2935 NIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQ 2999
            ::..:.::|||......||..|:::..|.|:..:|.||.:|||..:||.||...||    .:::.
 Frog  2424 DVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIV----EKMQA 2484

  Fly  3000 LGIVDNRE------NCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQ 3058
            :...:.|:      ..:.:|||||::.|.:||..||:|...|.|.|.||:|:||.|||||..||.
 Frog  2485 IARTEGRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPT 2549

  Fly  3059 QALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALY 3123
            .|||.|:.:||.:: .|..::...|.:...:..:||..:|..|....:|:||.||.|:||||..:
 Frog  2550 DALEMVANKFLEDV-ALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTF 2613

  Fly  3124 SKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENE 3188
            ..||:.|.:.....|.|...||.||...:.:|..:|..|...:.||...:.|.:.::|.:..|..
 Frog  2614 KTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETI 2678

  Fly  3189 KVSKERAFASKEEKNVRQIEEDVTAKAKL----CEEDFLKAQPALIAAQEALNTLNKNNLTELKS 3249
            :|..::...|.:||    :..:..|.:|.    ||.|..:|.|||.||..||:|||::::|.:||
 Frog  2679 EVDAKKELVSADEK----VANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKS 2739

  Fly  3250 FGSPPDAVVSVCGAVLVLFSSK----------GKIPKDRSWKACRAFMGNVDKFLDNLINYDKKH 3304
            ..:||..|..|..::.|:.:.|          ||:.:| .|...:..:|:: ||||.|..:||.:
 Frog  2740 MTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVED-FWGPSKKVLGDL-KFLDGLKAFDKDN 2802

  Fly  3305 IHPDVIKALQPYILD-AEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEV 3368
            |.|.|:|.::...:| .:|.|..|...|||..|||.||..:..:..|..||.||...|.|:|.::
 Frog  2803 ISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKL 2867

  Fly  3369 KDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIR 3433
            .....:|......|..:|::|.||..|..:...||.:.::.....:..:..|.:||.||..||.|
 Frog  2868 FIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDR 2932

  Fly  3434 WMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPF 3498
            |.|:.::|......|.||:|:.|..::|:|.||..||.|.|.: |....|..:  ||.:|.....
 Frog  2933 WTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQ-WQILCKEKK--IPCSDDFSLS 2994

  Fly  3499 EMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLVVLRLS 3562
            ..:.|..::..|...|||.|..|.:|..|:..|.|:|||||||.|..||:|. :....|.|::||
 Frog  2995 STLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNMEKANKLFVIKLS 3059

  Fly  3563 QRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRLIL 3625
            ..:|...:|.|:..|:.:|:||:||.||.||.|||.:|..|:..|  :::|:..|:::..|||.:
 Frog  3060 DASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYM 3124

  Fly  3626 HTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKF 3690
            .|:|.||||.||:..:..|:||.:|..||:||||..|...|:|:||..:.:|..:....|..||.
 Frog  3125 TTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKE 3189

  Fly  3691 LEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERAS 3755
            :||.:|..|||:..|:|||.|.:..|..:|..::||..|...|..|..:|||.|..|:|.|..:|
 Frog  3190 IEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSS 3254

  Fly  3756 IIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFE 3820
            ||:|.::||..|.|:||:||..|..::.:::..:..:|.|.:|:||:|...|...:....|.|||
 Frog  3255 IIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFE 3319

  Fly  3821 QDKLIFLTQLCIQILVNLGEVEPTELDFLLR------FPYMPNQTSNFTWLTHVGWGGIRALNNQ 3879
            :|||:|...|.|.|:....::......|||.      .|| ||..|  .||:...|..|...:|.
 Frog  3320 KDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPY-PNPAS--LWLSDKSWAEIVRASNL 3381

  Fly  3880 AVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRMSYAMRSFIEE 3944
            ....|....::.:..:||...||..|::||.|.:|:..:.|.||.::||:|||:|..|::.||.|
 Frog  3382 EPLSGFMNHVKDNISKWKTIYDSLKPQDEKLPDKWQELNGINRLVVLRCLRPDKMVPAVQEFISE 3446

  Fly  3945 KLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQG 4009
            .:|.|:|:..:.:.:.::.:|:....:.||||||.||:..:.|....||..  .|:..::|||||
 Frog  3447 NMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMG--GESIQTISLGQG 3509

  Fly  4010 QEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSL--SNVHTSYRLFLSAEPAGDPAA 4072
            |..:||..|..|.:.|.||:|||.||...|:.:|||..|..:  .|.|..:||:|::.|:..   
 Frog  3510 QGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPENTHEKFRLWLTSYPSDK--- 3571

  Fly  4073 HILPQGILESAIKITNEPPTGMMANIHKAL--DNFSDET-LEMCSKETEFKAILFSLCYFHAVVA 4134
              .|..||::.||:|||||.|:.||:.::.  |..||.| ...|.|...::.:||.||:|||:|.
 Frog  3572 --FPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQ 3634

  Fly  4135 ERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRR-- 4197
            |||.|||.|||..|.||..||.||:..|..:|.....||:|.|.||.||..|||.:|||.|||  
 Frog  3635 ERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLL 3699

  Fly  4198 LCR---TYLEEFMQPE--LIDGELEYCQGFPAPGILKYTGYHNYID--DNLP-SESPSLYGLHSN 4254
            ||.   .|.::..|.:  |..|: .||       :..|..|.:.:|  .:|| ...|.::|||.|
 Frog  3700 LCLLSIVYNKDIQQDKYRLSTGD-TYC-------VPSYGTYQSCVDYIRSLPLITHPEVFGLHEN 3756

  Fly  4255 AEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGRVE 4319
            |:|......:.:||..|....||.|.||..    |.::|::::.:|||:|.|..||:.::|    
 Frog  3757 ADITKDNQETNQLFSGVLLTLPRQTSGSGR----SPQEIVEDLAKDILNKLPKDFNLEKVM---- 3813

  Fly  4320 DRSPYI------IVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQ 4378
            ::.|.:      .|..||..|.|.|...::.||..|...:||::.:|:.:|::...:.:.:||..
 Frog  3814 EKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSM 3878

  Fly  4379 WTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWP 4443
            |...:|||:..|.|:.:||:.||:.|:||: |...|...|::||:..||.||.:.|..|||...|
 Frog  3879 WASKSYPSLKPLGSYVADLLSRLQFLQGWI-DNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIP 3942

  Fly  4444 LDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAV 4508
            :|.:....:|| :::.::..||.:|||:.|||:||||||.:...|.::..|.|:..:|::::|..
 Frog  3943 IDHIGFQFEVT-RYRNDVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPG 4006

  Fly  4509 TQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
            ...|....|.|.|||||...|..|         :|.:..|.|......||..||..|.|
 Frog  4007 ESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQ 4065

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 12/47 (26%)
DHC_N2 1368..1770 CDD:285579 113/424 (27%)
P-loop_NTPase 1903..2132 CDD:304359 147/229 (64%)
P-loop_NTPase 2217..2352 CDD:304359 54/142 (38%)
P-loop_NTPase 2510..2783 CDD:304359 94/288 (33%)
P-loop_NTPase 2860..3127 CDD:304359 105/274 (38%)
MT 3140..3480 CDD:289543 112/355 (32%)
AAA_9 3509..3722 CDD:289547 89/216 (41%)
Dynein_heavy 3864..4549 CDD:281078 252/715 (35%)
dnah3XP_012826767.1 DHC_N2 823..1221 CDD:285579 112/408 (27%)
P-loop_NTPase 1346..1576 CDD:304359 147/230 (64%)
P-loop_NTPase 1999..2258 CDD:304359 91/274 (33%)
P-loop_NTPase 2348..2617 CDD:304359 105/274 (38%)
MT 2634..2976 CDD:289543 110/349 (32%)
AAA_9 3006..3219 CDD:289547 88/213 (41%)
Dynein_heavy 3361..4056 CDD:281078 254/722 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.