DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and LOC100488188

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017947320.1 Gene:LOC100488188 ID: Length:5265 Species:Xenopus tropicalis

Alignment Length:5304 Identity:1079/5305 (20%)
Similarity:2084/5305 (39%) Gaps:1043/5305 (20%)


  Fly    22 LTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRI-IFTINSGGQLYPSYSFPVRPRYKVAYF 85
            ::.::|.:.|.....:..:::|..:.|||.|.:...: ::...:...|..|.|.|.....|...|
 Frog    12 ISSSLRPRTDDIKAFLLNHKYRSCLSEFLKNEDVHTLYVYFKLAKASLAASLSPPAVLHNKCICF 76

  Fly    86 IRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVIANDMKTESQ 150
            ::....:.||.||:..::|..|....||.....:..:|:.|||.|.....|.| .:|:.:.....
 Frog    77 LQLGKAVKLTLENIAQNVLCVDCARFPLKYFDAVLHQVYLPLLCNDSVTAGET-FVADKLIDLLH 140

  Fly   151 EMRNGIAQMKGLVINRTIFPLPICMDEVMQAAPAIAMGDISVVNPLMKHSLEFMVVKWLDSV--- 212
            .....:..:.|......:.|:|..  |:::.....:....::      |.:|..::.|:..:   
 Frog   141 RFAGNLEVLAGHAEGSIVLPMPSL--ELLKNPSLFSKNGAAI------HVMETTIIGWIKQIKFV 197

  Fly   213 ---EDLVNIKA-GEK--IYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIKTIGFVLEKIQS 271
               :.|..||. |.|  |:.:|         ..|:..:.||..::.||...:...|...||:.:|
 Frog   198 LKHDPLTEIKIHGSKADIHHEE---------KMWKLHIHNLHIISTQLSSAQATEIVSYLEEAES 253

  Fly   272 IFEHSYRRIVELVLESLAEARD-------ITKCLSPLKRKMDKFETNDMDENRSDIRPLMLTIGL 329
            .:..|...:...|.::|:||::       :.||...||      .|....|...::.|::..:.|
 Frog   254 TYGSSVGAVARDVRKALSEAKENLAFLKPLLKCFLLLK------STTSSSERVKNLLPMLHCLLL 312

  Fly   330 VWGHSRYFHT----LNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYK--------KLDIN 382
            ||.||||:|.    ||.:.|..|......:..:...:..:|....|:.||.|        .|||.
 Frog   313 VWTHSRYYHQRKVFLNLLKLMSNEMVKIAVSLLGTNILDNSQANNDLKEALKLCGTFRGTYLDIK 377

  Fly   383 M--------QHLEYYKLIYNECRNSLKKFK----IGTTFNSQDWT-------------------W 416
            :        ::.|..:||..:..:::...:    :......:||.                   |
 Frog   378 VKADKINSEKNEENARLIAKQSVDNIWNVRTYRQLAPKILGKDWASTKDKMQGEDDQELWVDSPW 442

  Fly   417 --HQDEIFGRLDKFLVRLEELKDLFNTVRDFQKLEKIV-MGGLKGRQITFALEKILEEYNSIYRE 478
              |....|..::.|:.|..::.||.:|::.||.|:.:| :||.....:...::.|.|.|......
 Frog   443 PPHNANCFYNMNLFMERCNDVLDLVDTMKHFQILKSVVAVGGAGTSSLDAMVQDIWESYKKAEET 507

  Fly   479 WTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLL------- 536
            :.: |...|....:||.|::|...|:.....:|..:........:...:  :|..|.|       
 Frog   508 FVH-QITDIFTTDKNSPFEKDFFDFRTTIKDLEHQLGGILRSSFDQCPN--IASQLRLLEVFKGI 569

  Fly   537 --RPIIKKHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTA------LGLNELPTDDCFPKVSGA 593
              |.||:.|:......:|..|.||:..|       :.:::|      |.:|..||      || .
 Frog   570 SRREIIRDHLTEKDQKLVSLFIEELTEV-------QTMYSATADSPPLHINMTPT------VS-K 620

  Fly   594 ISFLKKLRHRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQ 658
            :.:::.|:.||.....:.:.......:.:.|..:..::..:.||.:.:.:.::..|.....:.:.
 Frog   621 LLWIRGLKSRISDPMGKLKAVSSLTLEGDMGWKLRHLYKDIAQEFERYEESVMTSWQTAASKQLS 685

  Fly   659 QDITLTL-----IEKDEAN---ELRVNFTERLIFALKDIK-------VVRLLGCDVS----VNLT 704
            ..:.|.|     :|.|...   ::.:|....|:..|::.:       :::|.....|    ::|.
 Frog   686 NSVKLPLLRAAGLEHDHEEFFCKIELNHNAELLVCLREAEYLLKPPFMIKLPESTESLVKNLHLH 750

  Fly   705 KFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNA-FSQR 768
            ||       .:...:|..:|..||:..:.....::.|...:::..:|.:|..:||..|.. .|:.
 Frog   751 KF-------TELSARLETVASKYNEVMKTITYHQRSLFEKKLLKSQEILKEGMDFFTWGMDESED 808

  Fly   769 FIVMIFKMV-KYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAA 832
            :..::...| ..||........|.:||.:...:|                               
 Frog   809 YTELLTSCVCTDLHTNFSIVTNNYKAITQLTATW------------------------------- 842

  Fly   833 NAADTQRLIDLLMYVNLKLFF--DIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKR 895
                        ...||.:|.  |..|.||                    |:..:|...|.:   
 Frog   843 ------------CTANLDIFTCRDKSRSYS--------------------ITELIMMQTKLE--- 872

  Fly   896 EVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVIT 960
                     :||........::|.:..|:..:..|:|:...| :::|.:::|.::.:.|....||
 Frog   873 ---------QEFANILIPDGQKIHSLVHQSLVASGISEASPA-WQDYIMHIDSMVLQGLKKVTIT 927

  Fly   961 S-----STYLRMEVDNRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMM 1020
            |     :|.|..|       ..||..:.::|....|.:...||:|:...      ::::::...:
 Frog   928 SLASMLNTLLETE-------QIPILCVGVQLVNSEVSFTPPLDSSTSEW------SVIENIEEWL 979

  Fly  1021 SLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIW 1085
            .:.........|:::.....:...|.:..|..:....|:.:::..|:..:.....|.:::.||  
 Frog   980 KIFLLRGSHVKELSSAVKGGYQQYLSEDEEALQLIGHILQQVEQCLKECQEVLMDFNQYTHLW-- 1042

  Fly  1086 DKSTYLSEVKKFGRNLTLDERDAEADLEG---SSG-----------VKLLGLEY-------PPLS 1129
             |....:|.:.|     |..|.|:..:.|   :||           :.:|..::       |.|.
 Frog  1043 -KKDVNAEFQNF-----LSGRQADMSVMGERAASGANKSSVAEAERIFILPRDFSGQAHTGPLLQ 1101

  Fly  1130 VYKEQLDKFIELQDQIR--------TWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLIN 1186
            .:..::..:...:|.|:        .|         :::::...|..:.:...:|:..|...|::
 Frog  1102 DFDSEIAAYEAARDSIQGIPDVQNCQW---------IQVDLRPIKQVLTAYTLKWMWTFTKYLVD 1157

  Fly  1187 RVKNSLKELQDFVDEANIVLK-IELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLR 1250
            :..::|:.|..|:......:: |..::.|....:|::.:.|:::.||...|..|..|:..:.||.
 Frog  1158 QTSSTLRSLDSFLKSTEPQIESITGEERDTGSFMKMMRLFNKVSAKQVEMDVQFAVLQRTVTLLA 1222

  Fly  1251 QYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFL 1315
            ::..:...........:|..|..:|...:..||.:.|....:.|.:.:.:....:..:.:.....
 Frog  1223 KHGTQLPPESDVLFRTMPARWNSMKTKVSLAKQRLGPRIQQEADRVTRDLERFQHKLDAFGTDIE 1287

  Fly  1316 SKKFFFVPCLS--CYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIM 1378
            :...:...|.|  .:.:|...:..:..|:...:.|.|...|.|....|...:..|...|:.::::
 Frog  1288 TSDIYTCKCTSQEAFAIIQNFNTRVKMLQNEAKDLKELQELLESTVIDFSILTNCEDLLRNLQLV 1352

  Fly  1379 W---DFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLM 1440
            |   |..:..|:.   ||...|:.::.|.:.::..:..:.|:.|.:.::.|:.:......:.::.
 Frog  1353 WLNVDLILKEQAM---WKSKLWQNMETEELYKKNAQQLKLLQSLPREVQEWDIYKHTLEGVNSIH 1414

  Fly  1441 TSLRAVTELQNPAIRDRHWIELMQTT----KVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSV 1501
            .:|..:.:|.|||:|.|||.:|::.|    :|........||.||:.::|.::..:||.||.:::
 Frog  1415 MTLPLIEDLSNPAMRTRHWKQLVRQTGGMLRVTAESLQEVTLGDLLAMDLQKHTGDVKTIVQRAI 1479

  Fly  1502 KEMAMEKQLRDIATAWGTMEFGTDIHDRT------------------------------------ 1530
            :::.:|..|::....|.:..|....|.|.                                    
 Frog  1480 QDVTIESSLKNCEEVWLSRIFDLRPHSRVITARAHNEEIASSVSGSHYTKGDGRNIITGRGSRRM 1544

  Fly  1531 ---------------------------------SIKLLKASEELIETLEDHQGQLQNMASSKYIA 1562
                                             ::.||:.::.:.|.||.||..|..|.......
 Frog  1545 SRQSDKAFYLSRKGDRGSTMSLFESLKNIEEHGTVMLLRNTDAIFEELEHHQLLLTTMWPYAEAG 1609

  Fly  1563 FFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALL 1627
            .|..|:..|..:|...:..:..|..||.||..||.:| .:...|..:|.::..|..:...|..|:
 Frog  1610 SFLDELHKWHRKLQIIESTVQLWLSVQDKWTQLEEVF-STLPYRVAMPREAVLFADVHHHFCCLM 1673

  Fly  1628 AQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILS 1692
            ..:..:.|::::..|.|  |...|::|...|..|::|:..:||.||:::||.:|:|..|.|:|:.
 Frog  1674 KSVEDNPNILQTCMRGG--LQSLLDMLNYKLERCQRAVRLHLEQKRMAFPRLFFLSVEDTLNIVC 1736

  Fly  1693 NGNNPALVARHLTKLYDSMGKLNLISGSKNAA---------GMVAKELEEYVPFLENCDCSGKVE 1748
            .|.:..:::.::.|::..:  ||||..:...|         |:.:..:|| :...|..:|.|.||
 Frog  1737 YGYDLNVLSSYIMKVFPHI--LNLIVHTSEPASENFCPRIIGLRSYLMEE-LYLTEPLECRGPVE 1798

  Fly  1749 VWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVW--------------------IFEWPAQP---- 1789
            .||:::.|.::.:|:::|:.:|   :|.....|                    ..|..|.|    
 Frog  1799 SWLSQLVDSIKVSLQNKLREAL---EHTKNVQWSRKEIHSAGARRVVINKEPETDEKSASPLFPD 1860

  Fly  1790 ----------------------ALVGTQIMWTTETNDAFAK----VQQRYENALKD------YNK 1822
                                  |.:.|||.:|....:....    .:::.:..|||      |..
 Frog  1861 DVEGSSNSPTSRHCSVCTLSDVAFLSTQIKFTKALRETIGSSSEYSKEKLQQCLKDLTEGIEYAA 1925

  Fly  1823 KQITQL-------------------NNLIIL-------LLGD-------------------LTAA 1842
            |.:.::                   |..:.|       |:.|                   |:|.
 Frog  1926 KTLNEIPQKGIRQQSKRTSKAEREGNGQVHLDEQQRSELMNDNGGDSSEKQEESQQITNTSLSAC 1990

  Fly  1843 ERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQS---QLRHRWDPKIDDCFA---NICDAQF 1901
            :..|:.....:.::.|||          ||..|...:   :|.|..:.:.:|..|   .|.|::.
 Frog  1991 DSVKLANHILLLLYQRDV----------VQQYFNVAAPSLKLSHHLEYEYNDNGAISIRIGDSEI 2045

  Fly  1902 RYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFN 1966
            .|.|||.|....::|||||:|.:.:|..::........|||.|.||..|.::|..|||..::.||
 Frog  2046 LYGYEYQGPRKHMLITPLTERIFYSLITAVSSGTEAMCAGPQGHGKRSTVQELCMALGKPLFQFN 2110

  Fly  1967 CSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHI 2031
            |:|:.||..:.||.||||..|||.......::|...|.::|..::.||.|....|:..:...:.:
 Frog  2111 CTERTDYSILQDISKGLAAAGAWISISGLEQLSQSSLMLLAQLLEQIQSARHCGKEAVTLQLDEV 2175

  Fly  2032 ALRTTVGVFITMNPGYA--------GRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEAR 2088
            .|.:.......:|..|:        .::.||..|...:|...:.......|.|..|:.:||....
 Frog  2176 PLNSAGACIAIINRPYSTVNWNDFPQQSNLPHALLNCFRTVGICEAPVITILEAQLILKGFSNVG 2240

  Fly  2089 LLARKFITLYTLCKELLSKQ--------------DHYDWGLRAIKSVLVVAGA------------ 2127
            .||:|...|.    |..||.              .|.....|.|.::|..||.            
 Frog  2241 FLAQKLNALL----ESFSKMCQPSTLGAFSTGVGKHPYLSARGINNLLAEAGECLKCLQTAQEES 2301

  Fly  2128 -------LRRDDRQRPEDQVLMRALRDFNIPKIVTD--------------DVPVFM--------- 2162
                   ...|.:...|::.::.|:....:|:|..|              ...:|.         
 Frog  2302 KAQELKYTEEDCQLGIEEKAIILAIYHNWLPQISEDMKYMLKSMVSLEWPSALIFFNTLNNDNKM 2366

  Fly  2163 -GLIGDLFPALDVPRKRNPEFE---------AVIKRSALDLKLQPEDGFILKIVQLEELFAVRHS 2217
             ||:..:..|..|..::.|..|         |:|| :.....:.|.:.|:.|:..|.:|.:...:
 Frog  2367 DGLLSAVIDAKYVLGQQVPSSECAGETLVPSAIIK-AVEQCHIFPSNAFVSKVSHLVQLASKFQT 2430

  Fly  2218 VFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMR 2282
            :.:.|..|.||::..||..:|.:.:.:|.....:...|:....|.|.:|.   ||.|||...|:|
 Frog  2431 MVVTGPPGCGKTQCIKTCLETLKVEGKKVTTTTVFINALQPGHLMGFMND---EWIDGLLPKLLR 2492

  Fly  2283 ------DQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIAS 2341
                  ..|::...  :.:.|||::|...:|.:.:::....|....:||||.:...::|..|:.|
 Frog  2493 LLNQHCTSADVNKV--EALHLDGEVDHHQMEFMQSILCGADVFVAENNERIRIPDSLKLFLELES 2555

  Fly  2342 LRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRS 2406
            |...:|:.::..|||.:...|:.....:..|:.:..:..: .:|:.|.:.::.|.|...|...::
 Frog  2556 LANLSPSVLNCTGILAMTRCDVNCKLPLYVWIKSLADEHQ-QLLHELTETFLEPSLQFLRENQKA 2619

  Fly  2407 I--------TP----ISDIARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQ 2459
            :        ||    :|:...:|..|.:..:::  |.:| :...|..:.||:|..:|..||.|..
 Frog  2620 LADRDQKNGTPRTLFLSEANVVQTFCRISKALM--QQIP-EMTHDDIKKYFMFACIWSLGSWLNS 2681

  Fly  2460 DQIIDWSNEFSKWFLNEYK-AVKFPLSGTIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSN-L 2522
            |:    ..:||.|:...:: ...|||.|.::.:::|.:|::|..|.:.:..:.:.....:.|. .
 Frog  2682 DE----KRKFSNWWRRTFRHHSTFPLEGQVWDYHVDTDTRQFVRWHDTLSSYCVSQGQGMASEAF 2742

  Fly  2523 VNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYS---VTNVPFNFYTTS 2584
            |:|.:|.:|.:....|..:..|:||.|.||.|||.::...|::|.|.:.:   ...:|.|..|..
 Frog  2743 VHTLQTEQLLYLSSLLTTSGCPVMLAGNSGCGKTAIVRELLNSLCSGEVAEMLALRIPINTSTDP 2807

  Fly  2585 EMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK 2649
            ..|...|::.||.:.|..:.|.|||:::..:||:|:.:||::........|||.:|:...:|...
 Frog  2808 RKLWGCLKERLEWQHGTLHTPSGNKKLLCLLDDLNLAKVDEFGRQPACEFIRQLLDHEQIFDPSS 2872

  Fly  2650 MTLRDIHKCNIVACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFD 2714
            :.|:.:.....:|..|.:|...:...||.||||.|....||:.....|.:|:||.|...|..:| 
 Frog  2873 LKLKTMKDIYYLATWNLTASERSYAQRLLRHFCIFYCKYPSKSDQHGIFSSLLSAHFMQPATEF- 2936

  Fly  2715 KAVIKLC-------ENMVT--TAITLHL--KVVSSFLPTAIKFHYNFNLRDIANIFTGVLYS--N 2766
            ||..| |       :.:::  ||||:.|  ::.:.||.|:.:.||.|.|||:..||..:..|  .
 Frog  2937 KAGTK-CNTTAHQFQGLISSITAITIELQERLRTVFLRTSQRCHYIFTLRDLTKIFRNICLSLDG 3000

  Fly  2767 SETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVND-DVVYA--QPLIY 2828
            |.|   :.:::.||.|||..|||.::....|.|.::...:..|:|......: .::.:  |||  
 Frog  3001 STT---TEKILHLWRHECDWVYGQRMSSSVDYNRYQSEYAISVKKVFTSEEELQIILSPDQPL-- 3060

  Fly  2829 CHFAK------GL------------------TDIKYMPISGWDR------LKSLLDEAQDRYNDY 2863
              |:.      ||                  |......:.|:.:      .|.||.||...||..
 Frog  3061 --FSNIIEDDGGLITTVAKQQDSNLFRRSEKTSSTIHTLDGYQQTFNLIHTKQLLAEALREYNKA 3123

  Fly  2864 IGAMNLVLFDDAMSHVCRISRILESSR--GYALLIGVG-GSGKQSLTRLASFISSLDVFQIQL-- 2923
            ...|::..:...::.:||::|.:.|:.  .:.:|.|.| .....||.|||:.:|...|.||..  
 Frog  3124 NPRMSITFYKSTVNLLCRLTRNIGSTHESSHTMLCGEGCPRTTASLARLAAHLSGFSVVQIGSYN 3188

  Fly  2924 ---TKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDE 2985
               |::......::.:...|:|||:|......|:.:.::.... ||.:.:.:..|.:..||..::
 Frog  3189 KVETEEQQSKQFRSQLVDCYVKAGLKGQKIMILLAEEQIDNTA-LVQITEFIVFGSVSHLFTSEQ 3252

  Fly  2986 VENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTI 3050
            ...|.||:||||...|:..::|..|..|::.|:..::..|.:|...:|......||.:|:|...:
 Frog  3253 QATIANAMRNEVTNAGLTYSKERSWSLFLQAVQQNIRWFLIYSRTESTFYKWCLKFSSLMNSINV 3317

  Fly  3051 DWFHEWPQQALESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYT--TP 3113
            .:...|.::||...:...:.::.:...:....|.:.::.:|.:|...:|  :|:.|..|.|  |.
 Frog  3318 YFIPHWSREALVEHASYHIQDLDIWTAQEKENVCHLLSSMHLSVFKHNK--MAHFKYGNITNATF 3380

  Fly  3114 KSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADN 3178
            :.|.:......|..|..:   :.:....:..|.::....|..:.|...||.|::.|:..||....
 Frog  3381 EKFAQCFRAMVKTQHSMI---MTQHQEAKKVLGQVVEKLKSHEKLTHDLKNQKLVLEEHNQGTLK 3442

  Fly  3179 LIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNN 3243
            ::..:..:...|.::.....::.:.:::.:..:.......|:...|....|...:|.:|.:|...
 Frog  3443 ILYQIAQDKAVVEQKILSVHQQLQKIQRFQRLLPEYQVALEKAQYKCNALLEYIKELVNNMNIRE 3507

  Fly  3244 LTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSW-KACRAFMGNVDKFLDNLINYDKKHIHP 3307
            |.||::...|...:..:..:::::..|..   .|.:| |..:..|.|:|:||:.|:.:....:..
 Frog  3508 LGELRAMQKPDVDIEELMASIIIILKSPN---TDLTWAKGAKRQMANIDRFLNELLTFSSIKLPQ 3569

  Fly  3308 DVIKALQPYILDAEFSPEKILAKSS---AAAGLCSWVININRFYDVYL-VVEPKERALLESEKEV 3368
            ..::.|:..|..|:|:||.:..|:.   |...|..|:.....:|.:.. .|:|.:..:.|....:
 Frog  3570 STLELLENNIKKAQFTPENMERKTGGNLAVGTLMRWLQAAVHYYRILTSKVKPLQSKVEEMTLAL 3634

  Fly  3369 KDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIR 3433
            ::|..|:|:|..|...|..:||.|:..::||...|...|.:.::.:.:::.|:.:...|..|..:
 Frog  3635 EEAELKMTSLQQRKNALISRLNDLEKGFEEATVHKNLQQQKTTEISKSLEQADNISQLLGEENRK 3699

  Fly  3434 WMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDP- 3497
            ....|..|...:..:||...:.:...||:|.:...:||.:....|..|.|....|: ..|.||| 
 Frog  3700 HAAIVNSLLERLHGIPGSTAMAAGLASYLGTYEHDFRQFILTVEWPVALKERGFPL-MIDSVDPV 3763

  Fly  3498 ------FEMI--CD-------------------DAQIAEWNN-QGLPSDRMS------------- 3521
                  |.:|  |:                   |.:...|.| :|:..|.:|             
 Frog  3764 KGHVIEFSVIFTCESPRESQKLEQREKTDDPESDKEKGGWQNAEGIGPDILSPQRQFLPIITEEL 3828

  Fly  3522 ------------------------------AENAAILVQSERYP-LMIDPQLQGIKWVK----TK 3551
                                          .||:|||..:.:.| |:|||..:|.|.:|    :.
 Frog  3829 YGDFIKALLLRMVKRTQIQQWVAEDFTPQQMENSAILSFAWQCPVLLIDPCFKGEKRIKGCLESS 3893

  Fly  3552 YGTGL--VVLRLSQRN-YLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIK--------KG 3605
            .|..|  :.|:|.|.| .|..:|:.:.:|..|:::|.....|.:|.|||......        ..
 Frog  3894 LGKSLSSIDLQLRQNNSLLSPIEKTLLSGCPLMLQNYSRKWDDLLMPLLDHCSANTDNSSNEDTS 3958

  Fly  3606 TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDL 3670
            :::......:..:.:|:|.|......|::..|:.|.||:||::.....|.|.||........|||
 Frog  3959 SIISFNGHRLLCSDQFKLYLEASELEPNFNIEIHAGTTIINYSYCEGSLLDLLLRRAFAKLWPDL 4023

  Fly  3671 EAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKI 3735
            .:...:|:......:.||..||:.....|.|...:.::|...:..:...||...||   :...|.
 Frog  4024 HSQLMKLSADIMEHQKTLHQLEERTRDCLLSPDMSTVDDTIHIATVFNEKKKVFEI---LESTKS 4085

  Fly  3736 TGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFN---------NAMLKAMA 3791
            ...::..||::..|.|.|.::.||||..|..:...|.|:|::|..:|:         .|::|..:
 Frog  4086 NYNRLLQARDSLYPLAHRGTVFYFILKSLRSLAAEYYFTLESFLRLFDAVIGPQADAQALIKVQS 4150

  Fly  3792 AEKLKDRVENLIDSITFCSFVYTS---------------------------RGLFEQ-DKLIF-- 3826
            .:..|....:..:..|.|....|.                           |.|.:| .:.::  
 Frog  4151 GDLTKSAALSPSNQETDCQSTGTEDILPAPQGPDLSSIVESCYPSLSSNQIRKLMDQLTRAVYHR 4215

  Fly  3827 ---------------LTQLCIQILVNLGEVEPTELDFLLRFPY------MPNQTSNF---TWLTH 3867
                           |..||.|.|.|.......||.|   |.:      ..|..||.   :|:..
 Frog  4216 IIQCLLPEHSVQAGALLLLCAQQLDNEDAFTEEELAF---FAHGGDLFESKNIDSNCVPPSWMPQ 4277

  Fly  3868 VGWGGIRALN-NQAVFKGLEKDIEGSHKRWKKFVDS-----------ESPENEK-----FPGEWK 3915
            ..|..:.||: .....:...|.:......|:|:.::           |:.:.:|     :.||..
 Frog  4278 DRWNDLMALSLVSGPLRMFSKQVAEHSLEWEKWYNTDCTDTNNRGFDEAADKDKILLLPYCGEET 4342

  Fly  3916 GK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGV 3979
            .: :...||.::|.:|||:...|:..::.......:|.                         ||
 Frog  4343 SQMTDFHRLLLLRAMRPDKFPAALSYYVSSLASDDFIH-------------------------GV 4382

  Fly  3980 DPLKDVEKLGKSL------------------GFSFDHENFHSV--------------SLGQGQEI 4012
            |   ::.||.:.|                  |...:||...|:              |:.:|::.
 Frog  4383 D---NIAKLEEDLIGVLVIMPPKNNNSSSFGGTVLNHEAKISICNAAKEKGIPLFVESMKEGKDE 4444

  Fly  4013 VAENAIEIASQYGHWVILQNIHLVAR-WLPSLEK------KMESSLSNVHTSYRLFLSAEP-AGD 4069
            ..:.||..|.....|:|::|:.:.:: .|.:|.|      ||::| .|....:.::|::|| |..
 Frog  4445 EVKEAINEAMNQNGWLIIENLQVASKNMLKNLCKSLTYATKMQAS-QNGERQFCVWLTSEPGAAI 4508

  Fly  4070 PAAHILPQGILESAIKITNEPP--------------TGMM-ANIHKALDNFSDET-LEMCSKETE 4118
            |...:.....:...|.|.|:..              :|:: :.|..|:|...:|| :::......
 Frog  4509 PKKFLACLKTVSWHILIMNQKSRKTLLKDVTYIDSLSGLLYSAILSAVDQIKEETSVKLKESPIA 4573

  Fly  4119 FKAILFSLCYFHAVVAERRKFGPQGWNRSY---PFNVG---DLTISVYVLYNYLEANTRVPWEDL 4177
            .:.|.:.:|..|.::..::.|...|.|...   |..:.   |..:|.:...|..|.......|.:
 Frog  4574 VRNICYGICVLHGILQTQKIFPMTGMNHIMDLGPLQLNQAIDTALSAFQKDNENEGFAAAVEEGV 4638

  Fly  4178 RYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQ--------GFPAPGILKYTGYH 4234
            ..::|.:.:   .::|      .||::..:|..::..:.:...        .|| |..::.:.|.
 Frog  4639 SSVYGSLFW---TSED------VTYVQTLVQEVIVASQEQQDSLVLSHLTISFP-PANVEPSQYS 4693

  Fly  4235 NYIDDNLPSESPSLYGLHSNAEIGFL------------TTVSERLFRIVFELQPRMTG----GSS 4283
            |::          :..:|.|..:..|            |.|:|.:..:. .|.....|    ...
 Frog  4694 NWL----------ISQMHQNYSVNELLLLRDTEKAASKTYVTEFMHSLA-SLYDAFKGVLPLSIP 4747

  Fly  4284 GGE-TVSQEDIIKNIIEDILDKTPTPFNILE---LMGRVEDRSP-YII--VAFQECERMNNLMTE 4341
            |.| :..|..:::.:||.:.::.|....|:|   .|.:.|.:.. |::  :..|||..||:.:..
 Frog  4748 GNEYSAKQLTVLRALIETVSEQLPPLIRIIESESFMNKFETQGELYMMSQIILQECNHMNSYIEY 4812

  Fly  4342 LKRSLNE-LDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAY--PSMLGLQSWFSDLMLRLRE 4403
            :|.:::| |...|.|.....:.:::....|..:.||..|..|.|  ...|.:.||..||..:.::
 Frog  4813 IKAAISELLKCLLSGLSDAPNHLKEAADALLKNVVPRMWLYLHYSHADCLNISSWLQDLDKKYKQ 4877

  Fly  4404 LEGWVADFRMP---------SSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTK--KW 4457
            |..||....|.         :|:.|.|.|||::|..|:..:.|..:.:.|.::.|.|.:::  .:
 Frog  4878 LSQWVKKGLMSFVNDEKGALTSMNLGGMFNPEALFLALRTEFALHHGYSLHKVLLQCHISEYPVY 4942

  Fly  4458 KEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAV----TQDKQDIKNV 4518
            |.::   .|...|:..:.:.||.||.|...|.::  ..|...:|.:.|...    .:.:|:....
 Frog  4943 KADM---ERYQLYVEKIILHGAGWDFKNNCIKES--SNLETHLPFVIISPTLIENIKSEQEGFET 5002

  Fly  4519 YECPVYKIRLRGPTFVWTFNLKSRERASKWTLAGVCLLL 4557
            ||||||..:.. ...|..|.:.......:|.|..|.::|
 Frog  5003 YECPVYMDKTM-KNCVTKFPILCPRPIRQWKLRRVAIIL 5040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 129/662 (19%)
DHC_N2 1368..1770 CDD:285579 105/487 (22%)
P-loop_NTPase 1903..2132 CDD:304359 71/270 (26%)
P-loop_NTPase 2217..2352 CDD:304359 35/141 (25%)
P-loop_NTPase 2510..2783 CDD:304359 86/290 (30%)
P-loop_NTPase 2860..3127 CDD:304359 64/277 (23%)
MT 3140..3480 CDD:289543 70/345 (20%)
AAA_9 3509..3722 CDD:289547 61/273 (22%)
Dynein_heavy 3864..4549 CDD:281078 158/814 (19%)
LOC100488188XP_017947320.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.