DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and LOC100488102

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017950351.1 Gene:LOC100488102 ID: Length:4622 Species:Xenopus tropicalis

Alignment Length:4767 Identity:1413/4768 (30%)
Similarity:2333/4768 (49%) Gaps:557/4768 (12%)


  Fly    17 FFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKRIIFTINSGGQLYPSYSFPVRPRYK 81
            ||:..:.:|.:..:..|......|      ..:.|  .:|::..|:.|...|..:..|.:|...|
 Frog   182 FFYQEVVQTCKPNIPMWADGANLN------ASYTN--LQKKLFITVGSSEGLTGTCLFFLRTTEK 238

  Fly    82 VAYFIRYLTPLHLTDENMLNSLLIGDLLPNPLANLSILCDEVFFPLLNNTVNQVGWTNVIANDMK 146
            .      :|..:::.|  :|..:......:.|..|..|..:|..|.|.   .|..| .|:.:.|:
 Frog   239 A------ITTANISQE--VNFSMFECTNGSILHGLETLLSQVMVPSLK---CQENW-GVVTDGMQ 291

  Fly   147 T-ESQEMRNGIAQMKGLV---------------INRTIFPLPICMDEVMQAAPAIAMGDISVVNP 195
            . :.||..:.:.:..|.:               ::...|     ::.:...:..|..|.    |.
 Frog   292 NLQIQEYLDSLDKFIGTLSSARHNLEGKIELKRVDSGNF-----LENMHNPSDFINAGG----NS 347

  Fly   196 LMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLENLAEQLGDRRIK 260
            .:...||.|:..|:..:|.:  :...|::..:.:...|.|....|:||:.:..:|.:::...::|
 Frog   348 EIIEKLEAMLSIWIKQIEQV--LAESEQMRKEADDIGPSAELEHWKSRMSSFNSLLDEIKSPKVK 410

  Fly   261 TIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKR---KMDKFETNDMDENRSDIRP 322
            .:..:|:..:|.....::.:...|..:..||:|..|.|..|.:   .:.|.....|.|:   |..
 Frog   411 KVLSILQAAKSRILKKWKELDCNVTNAANEAKDNVKYLYTLDKFFGPLGKASPATMVEH---IPS 472

  Fly   323 LMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKKL-DINMQHL 386
            ||.:|.:::..|:|::|..:||..|       :...|:||   |..:..:.....|: |::.|.|
 Frog   473 LMNSIRMIYSTSQYYNTSEHMTSLF-------LKVTNQTV---STCKSYLSHGVIKIWDLDRQEL 527

  Fly   387 -----------EYYKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFN 440
                       |.|:..:::.:..||:     |.|.:.:.:.::.|||:||.|..|||::.|:.|
 Frog   528 IRRIKECVFLNEQYQNSFHKVKEKLKE-----TPNERQFEFSENYIFGKLDTFCKRLEKISDISN 587

  Fly   441 TVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKA 505
            .:.....|:.|.:.|         :|||...|.:|.....:..|:.:|...:.  |.:|.:.||.
 Frog   588 NLESLADLQTIKIEG---------VEKISIRYETIVTNTKSKSYDVLDHRKQE--FDKDYMEFKN 641

  Fly   506 KTD----VMERMVSFQFEKGLEDTHDLLLAGSLL--LRPIIKKHVEPLMHVIVDDFEEEIMCVKK 564
            :.:    .::..|...|||.| .|..::   :||  ...|.|.|:         ||.|:.|.|.:
 Frog   642 QIEGLYQSLQAFVDSWFEKPL-TTEQMI---NLLKKFERIGKDHL---------DFGEKYMIVLQ 693

  Fly   565 EFINFKNVFTALGLNEL---PTDDCFPKVSGAI--------------SFLKKLRHRIIGLHKEHE 612
            .:....::...|...:.   ||....|.::|.|              .|||.....:.||..:..
 Frog   694 RYSRDLDMVRKLYQKQKENPPTPRNTPPITGKIMWARQLFRKIDQPMKFLKTKPELLKGLEMKKI 758

  Fly   613 LYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVEC----WQGIQQDITLTLIEKDEANE 673
            :..|               |.|...:.:| ::|..:...:|    ..|:...:   |:......|
 Frog   759 IRHY---------------NKMASVLMEF-ELLYHRGWCKCADIAKNGLHASL---LVRHPNTKE 804

  Fly   674 LRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTF------- 731
            |.||....::..|.:.|.::.:|.:|...:.....|.|     .:|..:|    |..|       
 Frog   805 LYVNLDPMVMEVLHETKYLQKMGFEVPDVILSMATRGD-----HIKAQQI----NSEFIVPSTMG 860

  Fly   732 ERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKMVKYLHDRLVA----AQENLE 792
            .|..|.     ||:.....:|..|.   ..|:    :.:|.:....||....||.    ...||.
 Frog   861 SRPGPD-----AAKQAQSRKQPPPC---FTWD----KVMVWLHPSTKYSSSILVMNNGNNMHNLP 913

  Fly   793 AIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKLFFDIPR 857
            :|           ||.|:.....|.|:                   .:||.|             
 Frog   914 SI-----------LFSRQSKQVELCLY-------------------EMIDAL------------- 935

  Fly   858 RYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPF 922
            :..|.|.:                             |..:.:.......:.:|....:|.::..
 Frog   936 KNRLKPTD-----------------------------RNSLQDSFACAHLDTKQKTRCQECLSCS 971

  Fly   923 HRYELLKGLSQEER-ALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFMEL 986
            : |.::..|.|:.. :|.:..::.:|.|  :..:.::  ||.|...:: .:....||:|:..:.|
 Frog   972 Y-YNVIGHLCQKNTDSLVKCTKVSLDAI--KRRLHTI--SSVYQTAKL-TKDHTPTPLFKAEIHL 1030

  Fly   987 QEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSE- 1050
            ..||||...:|            |.|...:|...:::...|:|    ..:..:::....|.:.| 
 Frog  1031 AIPNVVMKPSL------------EDIQSAVNKATNIILSAAKD----IPLWKFAYLHHKQQQLEQ 1079

  Fly  1051 ------------------LDKQ--------RVEI-MNKIKLALQAVRVHG-KGFMEFSSLWIWDK 1087
                              ||||        :|.| ::.|.|:|:|...:. ..|.:||.:|..|.
 Frog  1080 NAARDLGDELTKMVVLKPLDKQISEHKDVTKVIIQLSTIVLSLKAEAANVLNSFTKFSGIWNQDV 1144

  Fly  1088 STYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETY- 1151
            .   .:||:|     ||..                   |.:|.::.||..:.:|:.||.....: 
 Frog  1145 E---EKVKEF-----LDTN-------------------PVMSEFRSQLSYYSQLETQISELPAHC 1182

  Fly  1152 ----EDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIE--- 1209
                .||      .....|:|::.:...|..:|...|..:....:.|:..|:|  |:..::.   
 Frog  1183 IVGSVDF------TTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFID--NLSKRLSRPV 1239

  Fly  1210 LQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKV 1274
            |..||..|   .:..|.:|.:.:...|.|..|::|...||.:|...|:|....:::.|..||..:
 Frog  1240 LDLDDVRG---AMDALKEIRDAEIRIDMMIGPIEESNSLLLKYELVFQDGNAERVDGLAYAWKNL 1301

  Fly  1275 KRLAATTKQLIAPIQ-SYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELID------ 1332
            ...|..|:.|:..:| ..:.||::.......:.|..|:.               |||:.      
 Frog  1302 NTQAVYTQNLLIKVQPEMKTDLLDGVEKFHIDAAEFYKN---------------YELLGPGVEGI 1351

  Fly  1333 ---ESDLELVALEERQRSLAESAVLF----ELQGPDPV----KIELCRFDLKLVKIMWDFAITIQ 1386
               |:...|...:.:...|....|.|    ||.|. ||    :::..|.:|.|::.::.....:.
 Frog  1352 PPREASDRLQVFQAKFDELWRKYVTFSGGEELFGL-PVTEYPELQRIRRELALLQKLYGLYNAVI 1415

  Fly  1387 STINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQN 1451
            ..||.:.:..|..:|||.::.|...|...:|.|.||::.|:.|..::..:.:...|...:..:.|
 Frog  1416 ENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMAN 1480

  Fly  1452 PAIRDRHWIELMQTTKVKFSMD-DSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIAT 1515
            .|:.:|||..:.|.|..||.:: :|.:||::::.:|.:|:|::::|...:|||..:|.:|:.:.:
 Frog  1481 KAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVIS 1545

  Fly  1516 AWGTMEFG-TDIHDRTSIKLLKASE--ELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSN 1577
            .|....|. |....|..: |||.|:  |.|..:||....|.::.|::|.|.|:..::.|..:|||
 Frog  1546 EWSAHCFTFTQFKSRGEL-LLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSN 1609

  Fly  1578 ADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRST-- 1640
            ..:||.:|..||..|.|||::|:|. ||..|||::::||..|||.::.::.:.:...|:|:..  
 Frog  1610 TTEIIENWLTVQNLWIYLEAVFVGG-DIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVG 1673

  Fly  1641 NRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLT 1705
            :.:.::|..|   ||:.|.:|:|:|..|||.|||.:|||:|||...||:||...::...:..||.
 Frog  1674 DETLAQLLPH---LLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLL 1735

  Fly  1706 KLYDSMGKLNLISGSKNAAGMVAKELE--EYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKR 1768
            .|:|::.::..  ..||...::..|.:  |.|..:|..:..|.|||||..:.:.::.||...:::
 Frog  1736 SLFDNVNRVGF--HEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQ 1798

  Fly  1769 SLTFYDHKPRHVWIFE--WPAQPALVGTQIMWTTETNDA--FAKVQQRYENALKDYNKKQITQLN 1829
            :..........::.|:  :|||..|:|.|::||.:..:|  .||..::   .::..|:|.:..||
 Frog  1799 ASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRK---VMQTTNQKFLDLLN 1860

  Fly  1830 NLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFA 1894
            :||.:...|||..||.|..|:.||.||.:|:...::...::..:.|:||.|.|..:...||.|..
 Frog  1861 DLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCII 1925

  Fly  1895 NICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALG 1959
            .|.|.:|.|..||||.|.|||||||||||||||:|:|.:.|||||||||||||||||||:|:.||
 Frog  1926 QITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLG 1990

  Fly  1960 MMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTF 2024
            ..|.|||||:||||:.:|.|:|||||:||||||||||||.:.||||.|.|:..:....||||..|
 Frog  1991 KYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQF 2055

  Fly  2025 SFL-GEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEAR 2088
            .|. |:.:.:....|:|:|||||||||.|||||||..:|..||:|||.|:|..:.|.:.||::.:
 Frog  2056 IFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQ 2120

  Fly  2089 LLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKI 2153
            :|:|||.|||.||:|.||||.|||:|||.|.|||...||::|.:...||..|:||.|||.|:.|:
 Frog  2121 ILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKL 2185

  Fly  2154 VTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSV 2218
            |.:|.|:||.||.||||.:.:.:...|:.||.|::...:..|.....:|||::||.|...|||.:
 Frog  2186 VDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGM 2250

  Fly  2219 FIIGFAGTGKSEVWKTLNKTYQNQKRKPHYN-DLNPKAVTNDELFGIVNPSTREWKDGLFSILMR 2282
            ..:|.:|.||::....|.|. ......||.. .:||||:|..::||.::.:|.:|.||:||.|.|
 Frog  2251 MTLGPSGAGKTKCINILMKA-MTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWR 2314

  Fly  2283 DQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATP 2347
            ...........||||||.:|.:|||:||:|:||||.||||:.:||.:....:::||..::..|:|
 Frog  2315 KTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASP 2379

  Fly  2348 ATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSEVSMLNVLFDKYVPPLLDIFRTRLRSITPISD 2412
            |||||.|:::::...|.|.|.:::||.|........:.| .|:.....||:...|.:.....|.:
 Frog  2380 ATVSRNGMVFMSSSVLDWRPMLKAWLQTLPAFQHEILWN-CFNSIFQDLLNFIFTAVSPKMQILE 2443

  Fly  2413 IARLQMTCYLLDSMLTPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNEY 2477
            ...::....||..:|:.::......:....: |:|.::|..|:.|..|..:....     ||.::
 Frog  2444 CMYIKQAIDLLQGLLSDKDEKQPSQEHVARL-FIFAVMWSIGALLELDDRMKMET-----FLQDH 2502

  Fly  2478 KA-VKFP-LSG--TIFSFYIDHETKKFFPWTNLVPQFELDMD-LP-LQSNLVNTAETTRLRFFMD 2536
            .| ::.| :||  |||.|.|| |..::..|:..||::....| :| ..|.||...:..|..|.|.
 Frog  2503 SAPLELPTVSGDQTIFEFVID-ENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMH 2566

  Fly  2537 TLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGR 2601
            |:::....::|||..|:.||:::....|....:.::..::.|:..|...|.||.:|..::|:.|.
 Frog  2567 TIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGT 2631

  Fly  2602 NYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQK----MTLRDIHKCNIVA 2662
            .|||...|:|..|:||:|||.::::.....:.::||.|:...:|:.:|    .::.||.  .:.|
 Frog  2632 TYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQ--FVAA 2694

  Fly  2663 CMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTT 2727
            .::|..|...|..||:|.|..|....||..::..|..::...:.... :.|...|.||...:|.|
 Frog  2695 MIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQ-RGFSTGVCKLASALVPT 2758

  Fly  2728 AITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKL 2792
            ...:........|||..||||.|||||::.|:.|:|...||.|.:::.::.|:.|||.||..|:.
 Frog  2759 TRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRF 2823

  Fly  2793 VDYTDINSFKKIVS----------------------DIVRKGIEGVND---DVVYAQPLIYCHFA 2832
            :|..|.:.|:..|.                      |.:|...|...|   |.....|.:     
 Frog  2824 IDQKDKDWFENTVHKIAVEDHGQEIMNNALKESYFVDFLRDAPEATGDEPEDADLEAPKV----- 2883

  Fly  2833 KGLTDIKYMPISGWDRLKSLLDEAQDRYNDYI--GAMNLVLFDDAMSHVCRISRILESSRGYALL 2895
                   |.||..:::|...||....:||:.:  ..|:||.|.|||.|:.:||||:.:.:|.|||
 Frog  2884 -------YEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALL 2941

  Fly  2896 IGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVA 2960
            :|||||||||||||||:|:....|||.||:.|..::|..::..||..||.|.....|:.||:|:.
 Frog  2942 VGVGGSGKQSLTRLASYIAGYQSFQITLTRTYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIK 3006

  Fly  2961 REQFLVLVNDLLASGDIHELFPDDEVENI----VNAVRNEVKQLGIVDNRENCWKYFIEKVRSLL 3021
            .|.||..:|::||||::..||..||::.|    :..::.|..:.  ....||.:.||:.:||..|
 Frog  3007 DESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRR--APTAENLYDYFLSRVRRNL 3069

  Fly  3022 KVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITV-LPKELALPVSN 3085
            .|||||||||...|.|:.|||.|::..|:|||..||:.||.:|:..|||...: ..:|:...|.|
 Frog  3070 HVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVN 3134

  Fly  3086 FMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVK--ANLDRRLRLENGLIKL 3148
            .|......|.:....|....:|..|.||||:|..|..|..:..||::  .||..|::  .||.||
 Frog  3135 TMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMK--TGLAKL 3197

  Fly  3149 ASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTA 3213
            ......|:.|...|.|:|.:|.:.:::||.::..|..:.....|.:....|.:...:.|.:::..
 Frog  3198 MEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAI 3262

  Fly  3214 KAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSK-GKIPKD 3277
            .....||....|:|||..|:.||.|:...::..::..|.||..::.:....|:||..| ..:..|
 Frog  3263 DKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTAD 3327

  Fly  3278 -------RSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAA 3335
                   .||......|.| ..||::|:.:.|..|..::::.||||:...:::.|.........|
 Frog  3328 PERPCVKPSWGEALKLMNN-SGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVA 3391

  Fly  3336 GLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEAL 3400
            |||||...:..|:.:...|.|.:..|.....::..|:.:|.....:|...:.:|:.:|..||.|:
 Frog  3392 GLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAM 3456

  Fly  3401 AKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCF 3465
            .:||...|:|......:..|..||.||..|||||.||.|.....|.:|.||:|:.:.|:||.|.|
 Frog  3457 REKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPF 3521

  Fly  3466 TRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQ 3530
            .:.||..|.: ||.....:.:  ||.::.::...|:.|:|.|.|||.||||:|.:|.:|..|:.:
 Frog  3522 NQEYRNLLLQ-LWKKEMNSRK--IPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTK 3583

  Fly  3531 SERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLN 3594
            :.|:||:||||.||..|:|.: ....|.|..|:.:.:...:|..:|.|..||||::||.:||.|:
 Frog  3584 ASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALD 3648

  Fly  3595 PLLGRQLIKKGTV--LKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQ 3657
            .:|.:..||.|:.  :|:||:|:|....|.|.:.||||||.|.||:.|:|.:|:||||..|||||
 Frog  3649 NVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQ 3713

  Fly  3658 LLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKT 3722
            ||..|:..|:.:|||.|.:|.::....|..::.|||:||.||:|...::::|.:|:..|..||.|
 Frog  3714 LLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKST 3778

  Fly  3723 ADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAML 3787
            |:|:..|:..|..|.|:|::|||.|||.|.|.||:||::.::..:|.:||.||:.|..:|:.:|.
 Frog  3779 AEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMD 3843

  Fly  3788 KAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR- 3851
            ::..::....|:.|:|:.:||..|.||:|||:|..|.:|...:.::|.:...::...|...|:: 
 Frog  3844 RSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKG 3908

  Fly  3852 --------FPYMPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENE 3908
                    ....|.:     |:..:.|..:..|:|...|..|...:..:.|.||.:.|.|:||..
 Frog  3909 GATLDLNSVEPKPKK-----WILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEA 3968

  Fly  3909 KFPGEWKG-KSAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIF 3972
            ..|..:.. ....:||.::|...|||.....|.:|.|.||.||.:...::....:.||...|.:.
 Frog  3969 PLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLV 4033

  Fly  3973 FVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVA 4037
            ..||.|.||.:::|:|.||     .:....::|:|||||:.|...:..:.|.|.|::|||.||..
 Frog  4034 CFLSMGSDPTENIERLSKS-----KNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGL 4093

  Fly  4038 RWLPSLEKKMESSLSNVHTSYRLFLSAEPAGDPAAH-ILPQGILESAIKITNEPPTGMMANIHKA 4101
            .::..|...: :....||..:|.:::.|      .| ..|..:|:|::|.|||||.|:.|.:.:.
 Frog  4094 DFMDELLDTV-TVTETVHDGFRTWITTE------VHPKFPINLLQSSVKFTNEPPQGVKAGLKRT 4151

  Fly  4102 LDNFSDETLEMCSKETEFKAILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYL 4166
            ....|.|.|:: :...::|.:|:.:.:.|..|.|||||||.|||..|.||..|...|:..:.|:|
 Frog  4152 YSGISQELLDV-TNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHL 4215

  Fly  4167 -EANTR--VPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFMQPELIDGELEYCQGFPAPGIL 4228
             |.:|:  |.|..|||:.||:.|||.:|||.|:.|..|:...:....:...:..:.:|:..|...
 Frog  4216 DEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGK 4280

  Fly  4229 KYTGYHNYIDDNLPSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDI 4293
            ....|..|||.....::|.::|||.||:|.:.|.::......:..:||:.:||.: |||  :|.:
 Frog  4281 TIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGA-GET--RESV 4342

  Fly  4294 IKNIIEDILDKTP---TPFNI---LELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLG 4352
            ::.:..::|:|.|   .|..:   |:.||.::   |..|...||.:||..::..::.:|.:|.|.
 Frog  4343 VQRLANEMLEKLPEDYIPHEVKARLQKMGPIQ---PMNIFLRQEIDRMQRVIARVRSTLIDLKLA 4404

  Fly  4353 LKGELTISSVMEDLMVCLYMDQVPEQWTKLAY-PSMLGLQSWFSDLMLRLRELEGWVADFRMPSS 4416
            :.|.:.:|..:.|.:..:|..::|:.|.|::: .|.||.  ||::|:.|.::...|:.|.| |:.
 Frog  4405 IDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGF--WFTELLERNQQFRSWLFDGR-PNQ 4466

  Fly  4417 IWLAGFFNPQSLLTAIMQQTARKN---EWPLDRMCLNCDVTKKWKEELTTAPRE---GAYINGLF 4475
            .|:.||||||..|||:.|:|.|.|   .|.||.:.|:.|||:..||::...|..   |.||.|||
 Frog  4467 FWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLF 4531

  Fly  4476 MEGARWDMKMGTIADAFLKELFPAMPVLYIKAV-TQDKQDIKN----VYECPVY-KIRLRGPTFV 4534
            ::||.||.:...:.::..|.||..:||:::.|| |.:..|:|.    ::.|||| |.|....|::
 Frog  4532 LDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNPADLKKQQGYLHACPVYKKPRRTDLTYI 4596

  Fly  4535 WTFNLKSRERASKWTLAGVCLL 4556
            ::..|:|.|....|||.|:.||
 Frog  4597 FSLFLRSIEVPDHWTLRGIALL 4618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 130/615 (21%)
DHC_N2 1368..1770 CDD:285579 125/410 (30%)
P-loop_NTPase 1903..2132 CDD:304359 143/230 (62%)
P-loop_NTPase 2217..2352 CDD:304359 54/136 (40%)
P-loop_NTPase 2510..2783 CDD:304359 80/279 (29%)
P-loop_NTPase 2860..3127 CDD:304359 113/274 (41%)
MT 3140..3480 CDD:289543 98/348 (28%)
AAA_9 3509..3722 CDD:289547 92/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 224/709 (32%)
LOC100488102XP_017950351.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.